SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_016354944.1.79318 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016354944.1.79318
Domain Number 1 Region: 37-517
Classification Level Classification E-value
Superfamily Sema domain 2.09e-98
Family Sema domain 0.00034
Further Details:      
 
Domain Number 2 Region: 1384-1507,1673-1829
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.71e-33
Family p120GAP domain-like 0.024
Further Details:      
 
Domain Number 3 Region: 856-947
Classification Level Classification E-value
Superfamily E set domains 0.000000000000293
Family Other IPT/TIG domains 0.03
Further Details:      
 
Domain Number 4 Region: 952-1037
Classification Level Classification E-value
Superfamily E set domains 0.000000000000777
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.064
Further Details:      
 
Domain Number 5 Region: 1039-1116
Classification Level Classification E-value
Superfamily E set domains 0.0000000000662
Family E-set domains of sugar-utilizing enzymes 0.033
Further Details:      
 
Domain Number 6 Region: 520-572
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000244
Family Plexin repeat 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_016354944.1.79318
Sequence length 1897
Comment PREDICTED: plexin-D1-like [Sinocyclocheilus anshuiensis]; AA=GCF_001515605.1; RF=representative genome; TAX=1608454; STAX=1608454; NAME=Sinocyclocheilus anshuiensis; AL=Scaffold; RT=Major
Sequence
MPPSTANRSSLGLLATVFAVFLTALQTRTAAALQIQQAFASPSRTNNFVVDAVSRRVYLA
AVNSLYQLNATLAREVETRTGPVLDNPLCHAPQLPQATCEHQKTLTDNHNKLLALDREQG
VLLACGSVYQGFCELRSMDNVSRVAVKFPQDGATVFPSMLNIVANHEKASTVGLVFRSHG
GAPRLLVGATYTGMGTEYFPKNHSKEDLRFENTPEIAIRSLNTKDLGRLFTYDINPSEDN
VFKIKQEVKQKNKLNFVHAFVHKNYSYIAINNDANTGLKESQPNSILARICLDTDDPRRS
AESRKLTESYIQMGIQCGSNGNIYNRLLSIYPVDISAQRAAGPEPYLFGVFARAGGQSAV
CAFRVAAVEEMIRQGRRNCSSGPNSDVQVLDSVIQGSGAECERKGAIKLQEEQLNCGAAH
LQHPLALRKPLRAPPIYEAPGLSSIAVDNVHNRTVVFLGTNRGRLRKLSLLANLSVANLW
SLRLAANEPVHHIMTFDSSDHNYLYLMTTHHLLRVQVSVCGLYSSCRECVSAGDAHCGWC
TLERRCSVQKDCSSGTLGRSWISTGDGVQQCPSMTIIPSEISRSAHMRDVGILINGSVPD
LQGLQLECDYGVGITTNATVHLDYGTTQIQTCPLLPPHMYPTIPFGKDHVTVPVAIRVNG
VTVVSGSFIIYECELTGEIHYKTACTSCLSAAWRCYWDPQLSVCVSSKVNTPHALLENSL
YCPRMLAYDVPPLPTGSTHVFSLELKNIEHGIELDCDFGDGQLCRAQWLDGLSVNCSRVI
LKTTMWSKIFNLNLRRRGTSTYIDSPKTMTVEVYSCSAGDSDCSQCWGRQAQGHICVWCE
NSCQQREQCHSITTRCPDPHIQKVEPLSGPLTGGTLLTVQGKNLGHSAAQINVSIGHVPC
RILPQLYTVSVRLVCETGASWEQTSDHVTVSVAGNAVGVSKDIFSFVEPRLLEFRPRQGP
LAGGTRLTIHGLFLDAGSTVNVKINRIQNCTVFMLSSDVIECVMPPAEAATAENVSVCVV
YDSQPCLSASPSFTFTYEKNPTISHIRPNRSFLSGGRSISVTGQGFNLVQSVRMEVSEVG
QTICSYVSSTLIVCQSPATNQSQQATAHFYLNEVLYRGEDASPSGRGPDEDEEPHADAFH
FDYVEDPQFYTANKEKLIKHHPGEPLILIINKGPSELDLTLQEYSVTIGSDLCDITFHNE
QLFHCTINRSLSTSTGELPVTVRVGHFRKVIAMVQMGGGSELAIIISIVVCCVLLLLCTV
ALVVYCTKSRRAERYWQKTLLQMEEMESQIRDEIRKGFAELQTDMTDLTKELNRTQGIPF
LEYKQFVTRTFFPKMCSDYERRLVQPVYENNPLGPRALSETHPLLQDWQSSNRMRPNLEE
GITLFSTLLNNKHFLVTFVHALEQQKDFAVRDRCSLASLLTIALHGKLEYYTSIMKELLV
DLIDASASKNPKLMLRRTESVVEKMLTNWMSICMYSYLKETVGEPFFLLLCAIKQQINKG
SIDAITGKARYTLNEEWLLRENIEAKPQNINVSFQGFGMDSVSVRVMNTDTICQVKDKIL
EAFYKNLPFSQWPREEDVDLEWFPEGRSSRILQDLDDTSVMEDGRKKLNTVFYYQIPDGA
SLAMSMKDKRENTLGRAKDLDTEKYVHLVLPHDEQTESRKSHRQSHRKKVLPEIYLTRLL
STKGTLQKFLDDLFQAILSIPPEKPPLAVKYFFDFLEEQADKRGITDPDTLHIWKTNSLP
LRFWVNILKNPQFVFDIDKTDHMDACLSVIAQAFIDACSLSDLQLGKDSPTNKLLYAKEI
PEYKKRVQCYYKQIQEMAPLSEQEMNAHLAEESRRYRNEFNTNLAIMEVYKYAKRYRNQV
VSALDSSPTARRTQLQHKFEQVIALVEDNIYECSSEA
Download sequence
Identical sequences XP_016354944.1.79318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]