SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_016417833.1.44103 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016417833.1.44103
Domain Number 1 Region: 37-519
Classification Level Classification E-value
Superfamily Sema domain 1.83e-98
Family Sema domain 0.00033
Further Details:      
 
Domain Number 2 Region: 1341-1464,1630-1786
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.1e-33
Family p120GAP domain-like 0.024
Further Details:      
 
Domain Number 3 Region: 843-935
Classification Level Classification E-value
Superfamily E set domains 0.000000000000178
Family Other IPT/TIG domains 0.03
Further Details:      
 
Domain Number 4 Region: 939-1024
Classification Level Classification E-value
Superfamily E set domains 0.000000000000942
Family Other IPT/TIG domains 0.068
Further Details:      
 
Domain Number 5 Region: 1026-1103
Classification Level Classification E-value
Superfamily E set domains 0.000000000127
Family E-set domains of sugar-utilizing enzymes 0.029
Further Details:      
 
Domain Number 6 Region: 522-574
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000209
Family Plexin repeat 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_016417833.1.44103
Sequence length 1854
Comment PREDICTED: plexin-D1-like [Sinocyclocheilus rhinocerous]; AA=GCF_001515625.1; RF=representative genome; TAX=307959; STAX=307959; NAME=Sinocyclocheilus rhinocerous; AL=Scaffold; RT=Major
Sequence
MPPSPANRSSLGLLATVFAVFLTALQTRTAAALQIQQAFASPTRTNNFVVDAVSRRVYLA
AVNSLYQLNATLAWEVETRTGPVLDNPLCHAPQLPQATCEHQKTLTDNHNKLLALDREQG
VLLACGSVYQGFCELRSMDNVSRVAVKFPQDGATVFPSMLNIVANHEKASTVGLVFRSHG
GAPRLLVGATYTGMGTEYFPKNHSKEDLRFENTPEIAIRSLNTKDLGRLFTYDINPSEDN
VFKIKQEVKQKNKLNFVHAFVHKNYSYIAINNDANTGLKESQPNSILARICLDTDDPRRS
AESRKLTESYIQMGIQCGSNGNIYNRLLSIYPVDISAQRAAGPEPYLFGVFAQAGGQSAV
CAFRVAAVEEMIRQGRRNCSSGPNSDVQVLDSVIQGSGAECERKGAIKVRLQEEQLNCGA
AHLQHPLALRKPLRAPPIYEAPGLSSIAVDNVHNRTVVFLGTNWGRLRKLSLLANLSVAN
QWSLRLAANEPVHHIMTFDPSDHNYLYLMTTHHLLRVQVSVCGLYSSCSECVSAGDAHCG
WCTLERRCSVQKDCSSGTLGRSWISTGDGVQQCPSMTITPSEISRSAHMRDLGILINGSV
PDLQGLQLECDYGVGITTSATVHLDYSTTQIQTCPLLPPHMYPTIPFGKDHVTVPVAIRV
NGVPVVSGSFIIYECKLTGEIHYKTACTSCLSAAHLHLIINMIQNSSSCPRMLAYDVTPL
PTGSTHVFSLELKNIEHGAELDCDFGDGQLYRAQWLDGPSVNCSGVTLKTTMWSKIFNLN
LRRRGTSTYIDSPKTMTVAVYSCSAGDSDCSQCWGRQAQGHICVWCENSCQQQEQCHSIT
TRCPDPHIQKVEPLSGPLTGGTLLTVQGKNLGHSAAQINVSIGHVPCRILPQHYTVSVRL
VCETGASWEQTSDHVTVSVAGNTVGVSKDIFSFVEPRLLEFRPRQGPLAGGTKLTIHGQF
LDAGSTVNVEINRTQNCTVFMLSSDVIECVMPPAEAAAAENVSVCVVYDSQPCLSASPSF
TFTYEKNPTISHIRPNRSFLSGGRSIAVTGHGFNLVQSVRMEVSGVGQTICSCVSSTLIV
CQSPAANQSQQATAHFYLNEVLYRGEDASPSGRGPDEDEEPHADAFHFEYVEDPQFYTAN
KEKLIKHHPGEPLILIINKGPSELDLMDLTLITLQRKHVRVGHFCKVIAMVQMGGGSELA
IVISIVVCCVLLLLCTVALVVYCTKSRRAERYWQKTLLQMEEMESQIRDEIRKGFAELQT
DMTDLTKELNRTQGIPFLEYKQFVTRTFFPKMCSDYERCLVQPVYENNPLGPRALSETHP
LLQDWQSSNRMRPNLEEGITLFSTLLNNKHFLVTFVHALEQQKDFAVRDRCSLASLLTIA
LHGKLEYYTSIMKELLVDLIDASASKNPKLMLRRTESVVEKMLTNWMSICMYSYLKETVG
EPFFLLLCAIKQQINKGSIDAITGKARYTLNEEWLLRENIEAKPQNINVSFQGFGMDSVS
VRVMNTDTICQVKDKILEAFYKNLPFSQWPREEDVDLEWFPEGRSSRILQDLDDTSVMED
GRKKLNTVFHYQIPDGASLAMSMKDKRENTLGRAKDLDTEKYVHLVLPHDELTESRKSHR
QSHRKKVLPEIYLTRLLSTKGTLQKFLDDLFQAILSIPPEKPPLAVKYFFDFLEEQADKR
GITDPDTLHIWKTNSLPLRFWVNILKNPQFVFDIDKTDHMDACLSVIAQAFIDACSLSDL
QLGKDSPTNKLLYAKEIPEYKKRVQCYYKQIQEMAPLSEQEMNAHLAEESRRYRNEFNTN
LAVMEVYKYAKRYRNQVLSALDSSPTARRTQLQHKFEQVIALVEDNIYECSSEA
Download sequence
Identical sequences XP_016417833.1.44103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]