SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_016431518.1.44103 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016431518.1.44103
Domain Number 1 Region: 37-524
Classification Level Classification E-value
Superfamily Sema domain 1.16e-89
Family Sema domain 0.00053
Further Details:      
 
Domain Number 2 Region: 1446-1569,1735-1891
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.29e-33
Family p120GAP domain-like 0.025
Further Details:      
 
Domain Number 3 Region: 1008-1101
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000662
Family Other IPT/TIG domains 0.057
Further Details:      
 
Domain Number 4 Region: 925-1010
Classification Level Classification E-value
Superfamily E set domains 0.00000000014
Family Other IPT/TIG domains 0.023
Further Details:      
 
Domain Number 5 Region: 527-579
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000192
Family Plexin repeat 0.0019
Further Details:      
 
Domain Number 6 Region: 1101-1178
Classification Level Classification E-value
Superfamily E set domains 0.000000000369
Family E-set domains of sugar-utilizing enzymes 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_016431518.1.44103
Sequence length 1959
Comment PREDICTED: LOW QUALITY PROTEIN: plexin-D1 [Sinocyclocheilus rhinocerous]; AA=GCF_001515625.1; RF=representative genome; TAX=307959; STAX=307959; NAME=Sinocyclocheilus rhinocerous; AL=Scaffold; RT=Major
Sequence
MPPSPADRRSLRLLAAALAVFLTALQARTAGALQIQQAFASPSRTNNFLVDAVSRRVYLA
AVNSLYQLNATLAREVETRTGPVLDNPLCHAPQLPQATCEHQKTLTDNHNKLLTLDRAQG
VLLACGSVFQGFCELRAMDDASRLAVRFPQDGATVFPSMLNIAANHENASTVGLVFRSHG
GAARLLVAATYTGMGSEYFPKNHSKEDLRFENTPEIAIRSLDIADIGRLFTYDINPSEDN
VFKIKQEVKQKNKLSFVRAFVHKSYSYIAINNDANAGVKESQPNSILARICLDTDAPRRS
AESRKLTESYIQMGLQCGSSGNIYSRLLSIYPADISSGGAAGAEPHLFGVFAQAGGRAAV
CAFRVLEVEERLQYGRRRCYCLSHLRNERVQTSXRAIDMRISELMSLTSVHSVFQLQEEQ
LNCGAAHLQHPLALRRPLRARPIYEAPGLSSIAVDNVHNRTVMFLGTSRGRLRKLSLLAN
LSMANQWSLKLASNEPVHHIMTFDPSDHNYLYLMTTHHLLRVQVSACGQYSSCSECVSAG
DAHCGWCTLERRCSVQKNCSSGTLGRSWISTGDGVQQCPSMTITPSEISRSAHMRDVGIL
INGSVPDLQGLQVECDYGVGITTNATVHLDYSTTQIQTCPLLPLHMYPTIPFGTDHVTVP
MAIRVNGVSVVSGNFTIYECERTGQIHFKTACTSCLSTAWHCYWDPRLNLCVSSKESTPH
VLLENSSSCPRMVAYDVPPLPSGSTHVFSLELKNIEHGAELDCDLGDGQLYRAQWLDGLA
VNCSGVTNLLGAHQGGKDPVERRQRRLDSVAPVGDQTGFYPHTGAIEGCESSTTLSTSTS
SEEDRRSVEPAPRGKETAERASDLSERALDLAVEVYSCSAGDSDCSQCWGRQTQGHMCVW
CDNSCQQRDQCHAITTRCPDLSSSKVEPLSGPLTGGTLLTVQGRNLGHSATQLNVSIGHV
PCSVLPQYYTVSVRLVCETGASWEQTSDHVTVRVAGNAVGVSKDIFSFVEPRLLEFTPQQ
GPLAGGTRLTIHGQFLDAGSTVNVKINRTQNCTIFMLSSDVIECVMPPAEAAAAENVSVC
VVYDDRPCLSASPSFTFTYEKNPTISHIRPNKSFLSGGRSISVTGYGFNLVQSVRMEVSG
IGQTICSCVSSTLIVCQSPATNQSQQATAHFYLNEVLYRGEDASPSGRGPDEDEEPHADA
FHFDYVEDPQFYTANKEKLIKHHPGEPLILIINKGPSELDLTLQEYSVTIGSDLCDITFH
NEQLFHCTINRSLSASTGELPVTVRVGHFQKVIAMVQMGGGSELAIIVSIVVCCVLLLLC
TVALVVYCTKSRRAERDWQKTLLQMEEMESQIRDEIRKGFAELQTDMTDLTKELSRTQGI
PFLEYKQFVTRTFFPKMCSDYERRLVQPMYENDPLGPRALSETHPLLQDWQSSNSVRPNL
EEGITLFSTLLNNKHFLVTFVHALEQQKDFAVRDRCNLASLLTIALHGKLEYYTSIMKEL
LVDLIDASASKNPKLMLRRTESVVEKMLTNWMSICMYSYLKETVGEPFFLLLCAIKQQIN
KGSIDAITGKARYTLNEEWLLRENIEAKPQNINVSFQGFGMDSVSVRVMNTDTICQVKDK
ILEAFYKNLPFSQWPREEDVDLEWFPEGRSSRILQDLDNTSVMEDGRKKLNTVFHYQIPD
GASLAMSMKDKRENTLGRVKDLDTEKYVHLVLPHDELTESRKSHRHSHRKKVLPEIYLTR
LLSTKGTLQKFLDDLFQAILSIPPEKPPLAIKYFFDFLEEQADKRGITDPDTLHIWKTNS
LPLRFWVNILKNPQFVFDIDKTDHMDACLSVIAQAFIDACSLSDLQLGKDSPTNKLLYAK
EIPEYKKRVQCYYKQIQEMAPLSEQEMNAHLAEESRRYRNEFNTNLAVMEVYKYAKRYRN
QVVSALDSSPTARRTQLQHKFEQVIALVEDNIYECSSEA
Download sequence
Identical sequences XP_016431518.1.44103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]