SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_016521467.1.10163 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016521467.1.10163
Domain Number 1 Region: 36-496
Classification Level Classification E-value
Superfamily Sema domain 1.96e-106
Family Sema domain 0.0002
Further Details:      
 
Domain Number 2 Region: 1375-1503
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.49e-16
Family p120GAP domain-like 0.012
Further Details:      
 
Domain Number 3 Region: 942-1034
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000318
Family Other IPT/TIG domains 0.016
Further Details:      
 
Domain Number 4 Region: 499-551
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000131
Family Plexin repeat 0.0023
Further Details:      
 
Domain Number 5 Region: 849-944
Classification Level Classification E-value
Superfamily E set domains 0.000000000000471
Family Other IPT/TIG domains 0.016
Further Details:      
 
Domain Number 6 Region: 1033-1076,1104-1156
Classification Level Classification E-value
Superfamily E set domains 0.000000000117
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_016521467.1.10163
Sequence length 1654
Comment PREDICTED: plexin-B1-like [Poecilia formosa]; AA=GCF_000485575.1; RF=representative genome; TAX=48698; STAX=48698; NAME=Poecilia formosa; AL=Scaffold; RT=Major
Sequence
MLASSISSSVLLFLLLLLLLPPAHPADASMQWVKLEGSPLSHLLLDPRVGQLFVGGVDHL
YQLTSDLEVMSHVKTGPLLDSPDCLPPIVAQDCPSATPTHNHNKLLLLEAGAEPGPGAEP
GPGAEPGSLIVCGSLFQGTCEKRSLSNISQLIYRTSNPVDTQYVAANDPRISTVAVVITT
RSKQEAGMPSGVLRLLMVGRGYTSRGPGDIPPITTRRLHPVAPPRRAFSQEEELGKLVVG
SYSEYNNHFVKAVAHGDHVYFLFSRRDMRHTKEYRTYASRLCSSDRSFYSYVEVPLLCRG
GYNLAQGAWLGDLSGTPALFVVMAAGQASTPIATSRSALCVYTMKDLDATMRRAQEVCYT
EGGLDSSGQEEAYIEYAVSSKCLKLPKESLSDYPCGGEHTPNPIASAVPLGVPPTVTLNT
QLTSVTAATEAGHTIAFLGDRDGRLHKVLVRPDRSGHLYGSLLVDGGGAICADLLLDESQ
HHVYVLTDDRVSKVPVSSCERQTDCLSCLSIRDPYCGWCVLEGRCSRKHECERHLLDNHW
LWSFEQTNQCVTVQSLQPANQSRDEQTQVTMSVVQLPVLQGAESLSCVFGSLPPQPAVVM
GTELTCQSPAPELLPPMPPGSDHMVLPVSLMFGHVTVAMGNMTFYDCGAVSRLNQSSQCL
SCVGSFWTCNWCPLDQICTHNHSCPRKLVLSHNDPPGPASCPLVSSLRGSSLVPMGLSTT
IVLEGRNLDVYQDEAQYVCVVEVEDVQLDLTAAVRKTEDNTHIFTCSPHQFQYRLSQLQY
SAAIYLRRGQRRIDASPGLRLHLYDCSAGQSDCSQCRAVPEEYSCVWCLGSPAPRCVYSQ
SCSGLPADTCPTPQITQVHPVTGPVEGGILVTITGSNLGTRYQDVVGGVKVADVPCVAQP
EGYQISTRVVCELQSSGNYRVGNVQVTVGTTPPGQSTQMFTYQNPKLTSLVPDKGPVSGG
TKVTIKGQQLLTGQTSDLTAFLDRQPCFILNEVTDSQFVCKTSSSNWTGPVPVWVFFGKA
NRTGPELTFRYLDDPVITKATPAESFYAGGRVIKVTGRNLDVVQEPVISVWVEPLEVQRV
KRRRRLALLTARQHLVFNGTMTTVSERCSVLSSSEITCPTPAVPPEVRVKGVWFQLDNVR
VHYDSIEGKSFTYYQNPQFFPLNRDAPDAPYRFKPGGVIAVEGLDLTRAMSKDEVRARLG
DQDCEVKTLDRTHLYCEPPENQPLSVDGSSELPMLKVFMGKLQADLGLVQYDSDSLLSPI
PLVAQISLGAGAAVIILSVLIVILMYRRKSKQALRDYKKVLLQLETLEINVGDQCRKEFT
DLMTEMMDLSSDVGGPGLPLLDYKTYAERIFFPGQQTALLSRQLDLPESRRPTVEQGLQQ
LNNLLNNRLFLTRFIHTLEAQQGFSQRDRGYVASLLTIALHDKLEYFTEVMKTLLQDLVQ
QYVAKNPKLMLRRTETVVEKMLTNWMSICLYSFLKEVAGEPLYMLYRAIKYQVDKGPVDA
VTGKAKRTLNDSHLLREDIDYSAMTLNVLVKNGVEVQPCPIKVLDTDTITQVKDKILDQV
YRGAPFSQRPAADSLDMEWRSGQAGHLTLSDDDVTAVVHGRWKRLNTLQHYKVPDGATVA
LIPRFLSSGVNQVFQTGESKNQHTSATRITQEIC
Download sequence
Identical sequences XP_016521467.1.10163 XP_016521468.1.10163 XP_016521469.1.10163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]