SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_016600261.1.99153 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016600261.1.99153
Domain Number 1 Region: 60-227
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 1.28e-18
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.0004
Further Details:      
 
Domain Number 2 Region: 370-380,423-538
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000144
Family Pseudo ankyrin repeat 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_016600261.1.99153
Sequence length 618
Comment Flavoprotein [Penicillium expansum]; AA=GCF_000769745.1; RF=representative genome; TAX=27334; STAX=27334; NAME=Penicillium expansum; strain=MD-8; AL=Contig; RT=Major
Sequence
MAVGFRPNISPIKKGNTITKGSWLSDMEVDGGCKETVIGNKAVQNATSSQPRRRRLLLST
DSAFADTVLPSLVQNPYIELRLITDEPSALLTGTNKIPHYMDTVDSQTFDKKTGARKWLK
AKTAELCEWADMLLVAPIDAGALGAMLAGLTNTLTLALLRGWVSKKPVILIPGMTVSEWD
HPLSTRQLDEISRFWPWIRTVKPVLWKSNGPEDLTILPWDGLEELHQTLETTLKVPPWEA
TLSTRAIPHGTTVPVKTASKSTSGTATGSTPQTKHTGNADFLPLEIWLNVFEDQLRDWET
AKAVGIPTHLPVPQEWQSHLPKMSTTASLEYTILRGSFAAIKKRIDALPRWKPLSDLACH
LIVKFSRTDILSYLTENHLDLLWTTSRLTNIPYRASAIYGNPNVLTWWRDAPALPNKEYM
ADAMDGASRAGFVDVLDWWLHSGLPLRYSERALEAASAEGRVPVLDWWKTASTNAPVSSP
LPLKVGKSVLLAAQSGRTASLAWWDASGIPYSHAENVARIASTHGHVHVLEFWYKLKGPK
MIFDNQVLVGPTKNGHDHILQWWKSCGMRVEFKTCDIEEALEDADPSSGAEGRVRRWWER
NGLNLGVGTSEWMRSKVL
Download sequence
Identical sequences A0A0A2IEY6
XP_016600261.1.99153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]