SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_016657774.1.67334 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016657774.1.67334
Domain Number 1 Region: 495-706
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.36e-54
Family DBL homology domain (DH-domain) 0.00018
Further Details:      
 
Domain Number 2 Region: 161-253
Classification Level Classification E-value
Superfamily BRCT domain 0.00000000000102
Family DNA topoisomerase II binding protein 1, TopBP1 0.055
Further Details:      
 
Domain Number 3 Region: 105-184
Classification Level Classification E-value
Superfamily BRCT domain 0.00000000000538
Family DNA ligase 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_016657774.1.67334
Sequence length 980
Comment PREDICTED: protein ECT2 isoform X2 [Acyrthosiphon pisum]; AA=GCF_000142985.2; RF=representative genome; TAX=7029; STAX=7029; NAME=Acyrthosiphon pisum; strain=LSR1; AL=Scaffold; RT=Major
Sequence
MDNKMSNLVEGVSSLESELSNFNIYLEKIYSSDSDVLLAIKKLNVSIKYLENLSDVNLLE
KNDILVTTLFEELAVKRPCFKILGRPALLELAESPKGLQGINRHRYCNALVGAIVSVTGI
QKRDEMARLLSLIRWMGGSFRESINYKTTHLVSGYACSAKSQYAYLHEIPVIGSSWLHAA
WERRDEMEFKAINSSFFSEHKLKPFHGAKICFSGFTEEERSHMVDVLLQNGGTPIEDEND
SEITHLVTKEGSSPLGDRDPNTAPCLRGVLAPKNLIQAFDKDDSSPNTRNGGLKRTLSVV
DGGNVSHETKKIRLQFLDMDCDEFLFKHPNPMSACLDQTDQTSVVNESSLDSIPPVKKNN
AEILKEAWFWTSVQYQSCALTKEYLLTNLNVSNTPTSARVMSSTLTLSSSSRARKRKRHL
DRLGSLLRPSPTPVATIGETSPTNSSGPSKRRSSAANTLDGLRLSCGSFLNFTNSPDHPS
PFKLPKDQDIVIKDKPFSPRYQVFSELLQTEINYVGVLKTIITVYKEPLEEMIDKEDCLL
NNTEIKIIFGNVLPIYQVHQEMLEELKCLATSWQEDSSIGSVFLKYSSELVKAYPPFVNF
FEKTREMLLQCDQTKPRFHAFLKVGQTRPECCRQSLQELLIRPVQRLPSVSLLLNDILKH
SDKNNPDHQALVSALASIREVMTHINEDKRKTEGQVVLFDIFNDIDNCPPHLVSSHRSFI
TKCDVVELSDNLSGRGDHLTIFVFSDVVEVCKKRKSFNGKSPKELNSGSHKLNGGAKSYK
HIKLMPLNIIKQVIDIRETEDCRNTFSLMIIDNHDFKERLYTFTMTGSNSSANHKNIFLK
NISQQVANTVCSGNILVSLDSQQLDIDTSEITTGTLGKAFKFASRTRIKVGRALSFNKTP
SKLKRAVSTMMSPVLSLTNNGGLGTHALTPSTQLANMHLASCTNLNEMSSDDHTFPSPPM
SVQPSRKNKTSMLSLSSAPR
Download sequence
Identical sequences XP_016657774.1.67334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]