SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_016663798.1.67334 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016663798.1.67334
Domain Number 1 Region: 52-513
Classification Level Classification E-value
Superfamily Sema domain 4.05e-114
Family Sema domain 0.0000845
Further Details:      
 
Domain Number 2 Region: 1396-1520,1703-1887
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.32e-43
Family p120GAP domain-like 0.024
Further Details:      
 
Domain Number 3 Region: 864-954
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000331
Family Other IPT/TIG domains 0.011
Further Details:      
 
Domain Number 4 Region: 959-1043
Classification Level Classification E-value
Superfamily E set domains 0.00000000000522
Family Other IPT/TIG domains 0.049
Further Details:      
 
Domain Number 5 Region: 1043-1119
Classification Level Classification E-value
Superfamily E set domains 0.000000000306
Family E-set domains of sugar-utilizing enzymes 0.04
Further Details:      
 
Domain Number 6 Region: 515-567
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000068
Family Plexin repeat 0.0023
Further Details:      
 
Weak hits

Sequence:  XP_016663798.1.67334
Domain Number - Region: 1175-1235
Classification Level Classification E-value
Superfamily E set domains 0.000165
Family E-set domains of sugar-utilizing enzymes 0.04
Further Details:      
 
Domain Number - Region: 827-860
Classification Level Classification E-value
Superfamily Plexin repeat 0.000196
Family Plexin repeat 0.0046
Further Details:      
 
Domain Number - Region: 665-701
Classification Level Classification E-value
Superfamily Plexin repeat 0.0445
Family Plexin repeat 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_016663798.1.67334
Sequence length 1923
Comment PREDICTED: plexin-B isoform X2 [Acyrthosiphon pisum]; AA=GCF_000142985.2; RF=representative genome; TAX=7029; STAX=7029; NAME=Acyrthosiphon pisum; strain=LSR1; AL=Scaffold; RT=Major
Sequence
MDWKFITVGKLVMPNSKLCFVLVLLLITTTLKCSSAMSVIAKYPQNTQSECFSNHLLHMA
VDKSLGGRVYIGAVNKLIQLEGSNLTVETCANTGPLLDSPQCPASGCPTSPPVETSLTDN
YNKILIIDLESRMLIVCGSIFQGACNKYKMSNVSLPAQFISMSIAANTEQASTYAFIGPE
HYNNWGSSNVLYVGTTFTNNGDYRHAVPAISSRSLYNLNLAETSFLKQSSLNINVNYRDR
FLVKYIYGFNSSDYAYFVVVQKHSPLPGQEELGYVTRLARVCIDDANYDSYTEVTLQCMV
KETSNSDDLVNYKLAQDLKLSNAGEDLAASLGIDTDDQVLVGSFSPSQGITNEPMPKSAI
CAFSMQYIESKFNENIHMCFNGTIKYRNMPYVSGLILQGNCPTAGSTGNILNFCEIGLKI
SGTEPITTQAAINFPDHLITSITLATTERNTIIFLGTSTGILKKVLLSSATHAVNYEELI
LDNGNAILPDTSLTSNGEHLYVLTRSNVLKVRVEHCYSFTNCSSCLEANDPYCGWCSLER
RCTVRSTCQKASHSSPRWLSLGTGQQCIDFEQINPDRIPIHQMSKLQLAIKTLPELPVGA
KYRCVFGKSDPLDAVVTQFGLQCSTPSIQSRPKIPKNQDHIYVSLSVRSSETNKDFVSRN
FAYYDCSAHTRCMECVKSQWACNWCVYENKCTNNVSSCQRIIISGENNPTRLKSHGAMFC
PRFVQPAQKILLPNGVPKEIVLQVENLPNPQVGHTGFQCIINIEGAKLMVPARVEEKYIV
CDKTTYSYETNSGEYDAMVSMVWNRNHHVDTINVTLYKCDILGSHREHPDCSLCVTRNRK
YHCTWCLSTCVYSETCSESSSNECPKPRIDMIKPLSGPIEGGTMVTIEGSNLGLNREDVW
GKIHIGGILCHLVDYEVSVKIVCKTGPSNTEKFASIVVGNNAGLTESSVHFNYKSVKLDK
VTPSMGPQSGGTLLAISGHNLNIGSSVTAFLDNFPCTVNTTHASSTRLTCVTSAANRPLT
VNSMHLIIDGSNRTLAKPFTYRSDPTVAEIKPLISFLSGGRMITVHGTNFDIIQKPEMVI
YVDSDFIHPINKTECIVLNSAQMECPSPSANGQFLKNIKSYRKRRRHATNGKYLDSYLTL
KIGFIMDNVAAVKDLEKHLKVLQSQIVYVQDPKYFQFSNTIKSYKGDTLVIEGENLNLAC
DESDVNVTIGMEVCNVTSLANTQLVCIPPQYQPQSIDDFGSPTKTGLPLVVVRVGKKLRF
NVGYLQYDVLSTYSFSPEAIAGAVTSALCIIIIFFIILFLYRRKSTQAEREYKRIQIQMD
TLESNVRSECKQAFAELQTDMTDLTADLESSGIPTLDHNEYILKVFFPGVRDHPILNESK
VVIAGSTTNYDAAMMQFEQLINNKHFVLSFIDTLESQKTFSIRDKVNVASLLMVVLMNKM
EYATDILRSLLLRLIDKSVMSKHPHLMLRRTESVVEKMLTNWMALNMYKYLKDYAGSSLF
LLYKAIKHQVEKGPVDALTYDARYSLSEDRLLREQIDHRVVNLYVMQDELDDKVQCKVLD
CDTISQVKSKILDAVYKNTAFSLRPSVYGVDLEWRHGRGGHLTLQDYDVTTKNLCGWKKL
NTLAHYGVKETAVMTLIPRQHDTYNKSCTSGYYSGPIISTTNGGIETGSSSNGTVYHLIR
STDSQQQYHTNKMPERTHKAIPEIFLTRLLSTKGTIQKFVDDFFSTILAANETLPPAVKW
LFDLFDDAAKKYNIIDPEVVHSWKSNSLPLRFWVNFIKNPDFIFDIDKTPTVDSCLSVIA
QTFMDSCSTSDHRLGKDSPSNKLLFAKDIPQYRETVLRFYSDIQKLPQITDQELSTTMQQ
LSVSHFGQFHIVSALKELYIYASKYNDAILDSLEMDPYCQKINLSHKLNKVAGTLEGDEA
AIC
Download sequence
Identical sequences J9K8R7
XP_016663798.1.67334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]