SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_016779096.1.37143 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016779096.1.37143
Domain Number 1 Region: 156-454
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.15e-74
Family Protein kinases, catalytic subunit 0.0000615
Further Details:      
 
Domain Number 2 Region: 1-114
Classification Level Classification E-value
Superfamily DEATH domain 1.65e-38
Family DEATH domain, DD 0.00000174
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_016779096.1.37143
Sequence length 460
Comment PREDICTED: interleukin-1 receptor-associated kinase 4 isoform X1 [Pan troglodytes]; AA=GCF_000001515.7; RF=representative genome; TAX=9598; STAX=9598; NAME=Pan troglodytes; AL=Chromosome; RT=Major
Sequence
MNKPITPSTYVRCLNVGLIRKLSDFIDPQEGWKKLAVAIKKPSGDDRYNQFHIRRFEALL
QTGKSPTSELLFDWGTTNCTVGDLVDLLIQNEFFAPASLLLPDAVPKTANTLPSKEAVTV
QQKQMPFYDKDRTLMTPVQNLEQSYMPPDSSSPENKSLEVSDTRFHSFSFYELKNVTNNF
DERPISVGGNKMGEGGFGVVYKGYVNNTTVAVKKLAAMVDITTEELKQQFDQEIKVMAKC
QHENLVELLGFSSDGDDLCLVYVYMPNGSLLDRLSCLDGTPPLSWHMRCKIAQGAANGIN
FLHENHHIHRDIKSANILLDEAFTAKISDFGLARASEKFAQTVMTSRIVGTTAYMAPEAL
RGEITPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMND
ADSTSVETMYSVASECLHEKKNKRPDIKKVQQLLQEMTAS
Download sequence
Identical sequences H2Q5R2
ENSPTRP00000008285 XP_001166075.1.37143 XP_001166114.1.37143 XP_009423848.1.37143 XP_016779093.1.37143 XP_016779094.1.37143 XP_016779096.1.37143 XP_016779097.1.37143 9598.ENSPTRP00000008285 ENSPTRP00000008285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]