SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_016782807.1.37143 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016782807.1.37143
Domain Number 1 Region: 1077-1154
Classification Level Classification E-value
Superfamily Immunoglobulin 9.62e-19
Family I set domains 0.0095
Further Details:      
 
Domain Number 2 Region: 691-764
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000159
Family I set domains 0.049
Further Details:      
 
Domain Number 3 Region: 474-527
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000034
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 
Domain Number 4 Region: 972-1052
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000153
Family I set domains 0.02
Further Details:      
 
Domain Number 5 Region: 187-247
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000497
Family TSP-1 type 1 repeat 0.0019
Further Details:      
 
Domain Number 6 Region: 242-302
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000144
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 7 Region: 339-393
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000017
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Domain Number 8 Region: 1193-1251
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000301
Family TSP-1 type 1 repeat 0.0075
Further Details:      
 
Domain Number 9 Region: 527-587
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000392
Family TSP-1 type 1 repeat 0.0029
Further Details:      
 
Domain Number 10 Region: 1245-1312
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000157
Family TSP-1 type 1 repeat 0.004
Further Details:      
 
Domain Number 11 Region: 583-648
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000183
Family TSP-1 type 1 repeat 0.0038
Further Details:      
 
Domain Number 12 Region: 1371-1427
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000994
Family TSP-1 type 1 repeat 0.0063
Further Details:      
 
Domain Number 13 Region: 109-169
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000288
Family TSP-1 type 1 repeat 0.0056
Further Details:      
 
Domain Number 14 Region: 415-471
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000484
Family TSP-1 type 1 repeat 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_016782807.1.37143
Sequence length 1463
Comment PREDICTED: ADAMTS-like protein 3 isoform X4 [Pan troglodytes]; AA=GCF_000001515.7; RF=representative genome; TAX=9598; STAX=9598; NAME=Pan troglodytes; AL=Chromosome; RT=Major
Sequence
MLENETRGHSGEENVIAVPLGSRSVRITVKGPAHLFIESKTLQGSKGEHSFNSPGVFVIE
NTTVEFQRGSERQTFKISGPLMADFIFKTRYTAAKDSVVQFFFYQPISHQWRQTDFFPCT
VTCGGGYQLNSAECVDIRLKRVVPDHYCHYYPENVKPKPKLKECSMDPCPSSDGFKEIMP
YDHFQPLPRWEHNPWTACSVSCGGGIQRRSFVCVEESMHGEILQVEEWKCMYAPKPKVMQ
TCNLFDCPKWIAMEWSQCTVTCGRGLRYRVVLCINHRGEHVGGCNPQLKLHIKEECVIPI
PCYKPKEKSPVEAKLPWLKQAQELEETRIATEEPTFIPEPWSACSTTCGPGVQVREVKCR
VLLTFTQTETELPEEECEGPKLPTERPCLLEACDESPASQELDVPLPEDSETTYDWEYAG
FTPCTATCLGGHQEAIAVCLHIQTQQTVNDSLCDMVHRPPAMSQACNTEPCPPRWHVGSW
GPCSATCGVGIQTRDVYCLHPGETPAPPEECRDEKPHALQACNQFDCPPGWHIEEWQQCS
RTCGGGTQNRRVTCRQLLTDGSFLNLSDELCQGPKASSHKSCARTDCPPHLAVGDWSKCS
VSCGVGIQRRKQVCQRLTAKGRRVPLSEMMCRDLPGLPLVRSCQMPECSKIKSEMKTKLG
EQGPQILSVQRVYIQTREEKRINLTIGSRAYLLPNASVIIKCPVRRFQKSLIQWEKDGRC
LQNSKRLGITKSGSLKIHGLAAPDIGVYRCIAGSAQETVVLKLIGTDNRLIARPALREPM
REYPGMDHSEANSLGVTWHKMRQMWNNKNDLYLDDDHISNQPFLRALLGHCSNSAGSTNS
WELKNKQFEAAVKQGAYSMDTAQFDELIRNMSQLMETGEVSDDLASQLIYQLVAELAKAQ
PTHMQWRGIQEETPPAAQLRGETGSVSQSSHAKNSGKLTFKPKGPVLMRQSQPPSISFNK
TINSRIGNTVYITKRTEVINILCDLITPSEATYTWTKDGTLLQPSVKIIFDGTGKIQIQN
PTRKEQGIYECSVANHLGSDVESSSVLYAEAPAILSVERNITKPEHNHLSVVVGGIVEAA
LGANVTIRCPVKGVPQPNITWLKRGGSLSGNFSLLFNGSLLLQNVSLENEGTYVCTATNA
LGKAVATSVLHLLERRWPESRIVFLQGHKKYVLQATNTRTNSNDPTGEPPPQEPFWEPGN
WSHCSATCGHLGARIQRPQCVMANGQEVSEALCDHLQKPLAGFEPCNIRDCPARWFTSVW
SQCSVSCGEGYHSRQVTCKRTKVNGTVQVVSPRACAPKDRPLGRKPCFGHPCVQWEPGNQ
CPGRCMGRAVRMQQRHTACQHNSSDSNCDDRRSFHFRPTLRRNCTSGACDVCWHTGPWKP
CTAACGRGFQSRKVDCIHTRSCKPVAKRHCVQKKKPISWRHCLGPSCDRDCTDTTHYCMF
VKHLNLCSLDRYKQRCCQSCQEG
Download sequence
Identical sequences XP_016782807.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]