SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_016784159.1.37143 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016784159.1.37143
Domain Number 1 Region: 78-329
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.65e-74
Family MHCK/EF2 kinase 0.0017
Further Details:      
 
Domain Number 2 Region: 545-699
Classification Level Classification E-value
Superfamily HCP-like 0.00000000000741
Family HCP-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_016784159.1.37143
Sequence length 725
Comment PREDICTED: eukaryotic elongation factor 2 kinase isoform X1 [Pan troglodytes]; AA=GCF_000001515.7; RF=representative genome; TAX=9598; STAX=9598; NAME=Pan troglodytes; AL=Chromosome; RT=Major
Sequence
MADEDLIFRLEGVDGSQSPRAGRDGDSDGDSDDEEGYFICPITDDPSSNQNVNSKVNKYY
SNLTKSERYSSSGSPANSFHFKEAWKHAIQKAKHMPDPWAEFHLEDIATERATRHRYNAV
TGEWLDDEVLIKMASQPFGRGAMRECFRTKKLSNFLHAQQWKGASNYVAKRYIEPVDRDV
YFEDVRLQMEAKLWGEEYNRHKPPKQVDIMQMCIIELKDRPGKPLFHLEHYIEGKYIKYN
SNSGFVRDDNIRLTPQAFSHFTFERSGHQLIVVDIQGVGDLYTDPQIHTETGTDFGDGNL
GVRGMALFFYSHACNRICESMGLAPFDLSPRERDAVNQNTKLLQSAKTILRGTEEKCGSP
RVRTLSGSRPPLLRPLSENSGDENMSDVTFDSLPSSPSSATPHSQKLDHLHWPVFSDLDN
MASRDHDHLDNHRESENSGDSGYPSEKRGELDDPEPREHGHSYSNQKYESDEDSLGSSGR
VCVEKWNLLNSSRLHLPRASAVALEVQRLNALDLEKKIGKSILGKVHLAMVRYHEGGRFC
EKGEEWDQESAVFHLEHAADLGELEAIVGLGLMYSQLPHHILADVSLKETEENKTKGFDY
LLKAAEAGDRQSMILVARAFDTGQNLSPDRCQDWVEALHWYNTALEMTDCDEGGEYDGMQ
NEPRYMMLAREAEMLFTGGYGLEKDPQRSGDLYTQAAEAAMEAMKGRLANQYYQKAEEAW
AQMEE
Download sequence
Identical sequences A0A2I3TJP1
ENSPTRP00000013439 XP_001161085.2.37143 XP_009428754.1.37143 XP_016784159.1.37143 ENSPTRP00000013439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]