SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_016786649.1.37143 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016786649.1.37143
Domain Number 1 Region: 24-295
Classification Level Classification E-value
Superfamily L domain-like 1.59e-57
Family Ngr ectodomain-like 0.000000678
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_016786649.1.37143
Sequence length 441
Comment PREDICTED: reticulon-4 receptor-like 1 isoform X1 [Pan troglodytes]; AA=GCF_000001515.7; RF=representative genome; TAX=9598; STAX=9598; NAME=Pan troglodytes; AL=Chromosome; RT=Major
Sequence
MLRKGCCVELLLLLVAAELPLGGGCPRDCVCYPAPMTVSCQAHNFAAIPEGIPVDSERVF
LQNNRISLLQPGRFSPAMVTLWMYSNNITYIHPGTFEGFVHLEELDLGDNRQLRTLAPET
FQGLVKLHALYLYKCGLSALPAGVFGGLHSLQYLYLQDNHIEYLQDGIFVDLVNLSHLFL
HGNKLWSLGPGTFRGLVNLDRLLLHENQLQWVHHKAFHDLRRLTTLFLFNNSLSELQGEC
LAPLGALEFLRLNGNPWDCGCRARSLWEWLQRFRGSSSAVPCVSPGLRHGQDLKLLRAED
FRNCTGPASPHQIKSHTLTTTDRAARKEHHSPHGPTRSKGHPHGPRPGHRKPGKNCTNPR
NRNQISKAGAGKQAPELPDYAPDYQHKFSFDIMPTARPKRKGKCARRTPIRAPSGVQQAS
SASSLGASLLAWTLGLAVTLR
Download sequence
Identical sequences H2QBU8
XP_016786649.1.37143 ENSPTRP00000014575 ENSPTRP00000014575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]