SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_016787166.1.37143 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016787166.1.37143
Domain Number 1 Region: 282-382
Classification Level Classification E-value
Superfamily HMG-box 6.81e-24
Family HMG-box 0.00000155
Further Details:      
 
Domain Number 2 Region: 555-653
Classification Level Classification E-value
Superfamily HMG-box 2.09e-22
Family HMG-box 0.00000378
Further Details:      
 
Domain Number 3 Region: 103-185
Classification Level Classification E-value
Superfamily HMG-box 2.75e-21
Family HMG-box 0.00000347
Further Details:      
 
Domain Number 4 Region: 194-273
Classification Level Classification E-value
Superfamily HMG-box 1.31e-18
Family HMG-box 0.001
Further Details:      
 
Domain Number 5 Region: 392-469
Classification Level Classification E-value
Superfamily HMG-box 7.2e-17
Family HMG-box 0.00000966
Further Details:      
 
Domain Number 6 Region: 480-559
Classification Level Classification E-value
Superfamily HMG-box 0.00000000000000144
Family HMG-box 0.00000536
Further Details:      
 
Weak hits

Sequence:  XP_016787166.1.37143
Domain Number - Region: 668-699
Classification Level Classification E-value
Superfamily ARM repeat 0.00806
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_016787166.1.37143
Sequence length 764
Comment PREDICTED: nucleolar transcription factor 1 isoform X1 [Pan troglodytes]; AA=GCF_000001515.7; RF=representative genome; TAX=9598; STAX=9598; NAME=Pan troglodytes; AL=Chromosome; RT=Major
Sequence
MNGEADCPTDLEMAAPKGQDRWSQEDMLTLLECMKNNLPSNDSSKFKTTESHMDWEKVAF
KDFSGDMCKLKWVEISNEVRKFRTLTELILDAQEHVKNPYKGKKLKKHPDFPKKPLTPYF
RFFMEKRAKYAKLHPEMSNLDLTKILSKKYKELPEKKKMKYIQDFQREKQEFERNLARFR
EDHPDLIQNAKKSDIPEKPKTPQQLWYTHEKKVYLKVRPDATTKEVKDSLGKQWSQLSDK
KRLKWIHKALEQRKEYEEIMRDYIQKHPELNISEEGITKSTLTKAERQLKDKFDGRPTKP
PPNSYSLYCAELMANMKDVPSTERMVLCSQQWKLLSQKEKDAYHKKCDQKKKDYEVELLR
FLESLPEEEQQRVLGEEKMLNINKKQATSPASKKPAQEGGKGGSEKPKRPVSAMFIFSEE
KRRQLQEERPELSESELTRLLARMWNDLSEKKKAKYKAREAALKAQSERKPGGEREERGK
LPESPKRAEEIWQQSVIGDYLARFKNDRVKALKAMEMTWNNMEKKEKLMWIKKAAEDQKR
YERELSEMRAPPAATNSSKKMKFQGEPKKPPMNGYQKFSQELLSNGELNHLPLKERMVEI
GSRWQRISQSQKEHYKKLAEEQQKQYKVHLDLWVKSLSPQDRAAYKEYISNKRKSMTKLR
GPNPKSSRTTLQSKSESEEDDEEDEDDEDEDEEEEDDENGDSSEDGGDSSESSSEDESED
GDENEEDDEDEDDDEDDDEDEDNESEGSSSSSSSSGDSSDSDSN
Download sequence
Identical sequences A0A2I2YRV4 A0A2J8UYF4 A0A2K5K9K9 A0A2K5WWV1 A0A2K5Y313 A0A2K6E0Y3 A0A2K6N346 A0A2K6PXB1 G7NIX4 K7B7K3 P17480
ENSP00000302640 ENSP00000390669 ENSP00000435708 gi|7657671|ref|NP_055048.1| ENSGGOP00000019420 ENSP00000302640 NP_055048.1.87134 NP_055048.1.92137 XP_003805916.1.60992 XP_004041605.1.27298 XP_004041606.1.27298 XP_005584466.1.63531 XP_005584467.1.63531 XP_006722122.1.92137 XP_006722123.1.92137 XP_006722124.1.92137 XP_008010622.1.81039 XP_008010623.1.81039 XP_010352263.1.97406 XP_010352264.1.97406 XP_011718126.1.29376 XP_011718137.1.29376 XP_011718146.1.29376 XP_011718155.1.29376 XP_011795479.1.43180 XP_011841296.1.47321 XP_014975328.1.72884 XP_014975329.1.72884 XP_014975330.1.72884 XP_014975331.1.72884 XP_016787166.1.37143 XP_016787167.1.37143 XP_016787169.1.37143 XP_016787170.1.37143 XP_016787171.1.37143 XP_017731532.1.44346 XP_018882901.1.27298 XP_018882902.1.27298 XP_018882903.1.27298 ENSP00000302640 ENSP00000390669 ENSP00000435708 ENSGGOP00000010690 9606.ENSP00000302640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]