SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_016794539.1.37143 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016794539.1.37143
Domain Number 1 Region: 178-362
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.56e-58
Family SPRY domain 0.00000104
Further Details:      
 
Domain Number 2 Region: 94-166
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000757
Family RING finger domain, C3HC4 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_016794539.1.37143
Sequence length 389
Comment PREDICTED: ret finger protein-like 2 isoform X1 [Pan troglodytes]; AA=GCF_000001515.7; RF=representative genome; TAX=9598; STAX=9598; NAME=Pan troglodytes; AL=Chromosome; RT=Major
Sequence
MEVAELGFPETAVSQSRICLCAVLCGHWDFADMMVIRSLSLIRLEGVEGRDPVGGGNLTN
KRPSCAPSPQDLSAQWKQLEDRGASSRRVDMAALFQEASSCPVCSDYLEKPMSLECGCAV
CFKCINSLQKEPHGEDLLCCCCSMVSRKNKIRRNRQLERLASHIKELEPKLKKILQMNPR
MRKFQVDMTLDADTANNFLLISDDLRSVRSGHIRQNRQDLAGRFDLSVCILGSPHFTCGR
HYWEVDVGTSTEWDLGVCRESVHRKGRIQLTTERGFWTVSLRDGSRLSASTVPLTFLFVD
RKLQRVGIFLDMGMQNVSFFDAEGGSHVYTFRSVSAEEPLRPFLAPSIPPNGDQGVLSIC
PLMNSGTTDAPVHPGEAKQTPTAKKQKTG
Download sequence
Identical sequences 9598.ENSPTRP00000024602 XP_016794539.1.37143 XP_016794540.1.37143 XP_016794541.1.37143 XP_016794542.1.37143 XP_016794543.1.37143 XP_016794544.1.37143 XP_016794545.1.37143 XP_016794546.1.37143 XP_525572.2.37143 ENSPTRP00000024602 ENSPTRP00000024602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]