SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_016805840.1.37143 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016805840.1.37143
Domain Number 1 Region: 314-413
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.27e-32
Family Ras-binding domain, RBD 0.0039
Further Details:      
 
Domain Number 2 Region: 449-561
Classification Level Classification E-value
Superfamily PH domain-like 4.66e-16
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_016805840.1.37143
Sequence length 1302
Comment PREDICTED: ras-associated and pleckstrin homology domains-containing protein 1 isoform X1 [Pan troglodytes]; AA=GCF_000001515.7; RF=representative genome; TAX=9598; STAX=9598; NAME=Pan troglodytes; AL=Chromosome; RT=Major
Sequence
MEQLSDEEIDHGAEEDSDKEDQDLDKMFGAWLGELDKLTQSLDSDKPMEPVKRSPLRQET
NMANFSYRFSIYNLNEALNHGETVDLDALMADLCSIEQELSSIGSGNSKRQITETKATQK
LPVSRHTLKHGTLKGLSSSSNRIAKPSHASYSLDDVTAQLEQASLSMDEAAQQSVLEDTK
PLVTNQHRRTASAGTVSDAEVHSISNSSRSSITSAASSMDSLDIDKVTRPQELDLTHQGQ
PITEHAISLRCSSKQAKRHIDFTEEQAELTPHSYLDRETSLLLRNIAGKPSHLLTKEEQA
AKLKAEKIRVALEKIKEAQVKKLVIRVHMSDDSSKTMMVDERQTVRQVLDNLMDKSHCGY
SLDWSLVETVSELQMERIFEDHENLVENLLNWTRDSQNKLIFMERIEKYALFKNPQNYLL
GKKETAEMADRNKEVLLEECFCGSSVTVPEIEGVLWLKDDGKKSWKKRYFLLRASGIYYV
PKGKAKVSRDLVCFLQLDHVNVYYGQDYRNKYKAPTDYCLVLKHPQIQKKSQYIKYLCCD
DVRTLHQWVNGIRIAKYGKQLYMNYQEALKRTESAYDWTSLSSSSIKSGSSSSSIPESQS
NHSNQSDSGVSDTQPAGHVRSQSIVSSVFSEAWKRGTQLEESSKARMESMNRLYTSLVPP
LSPQPKIVTPYTASQPSPPLPPPPPPPPPPPPPPPPPPPPLPSQSAPSAGSAAPMFVKYS
TITRLQNASQHSGALFKPPTPPVMQSQSVKPQILVPPNGVVPPPPPPPPPPTPGSAMAQL
KPAPCAPSLPQFSAPPPPLKIHQVQHITQVAPPTPPPPPPIPAPLPPQAPPKPLVTIPPP
TSTKTVAPVVTQAAPPTPTPPVPPAKKQPAFPASYIPPSPPTPPVPVPPPTLPKQQSFCA
KPPPSPLSPVPSVVKQIASQFPPPPTPPAMESQPLKPVPANVAPQSPPAVKAKPKWQPSS
IPVPSPDFPPPPPESSLVFPPPPPSPVPAPPPPPPPTASPTPDKSGSPGKKTSKTSSPGG
KKPPPTPQRNSSIKSSSGAEHPEPKRPSVDSLVSKFTPPAESGSPSKETLPPPAAPPKPG
KLNLSGVNLPGVLQQGCVSAKAPVLSGRGKDSMVEFPSPPSDSDFPPPPPETELPLPPIE
IPAVFSGNTSPKVAVVNPQPQQWSKMSVKKAPPPTRPKRNDSTRLTQAEISEQPTMATVV
PQVPTSPKSSLSVQPGFLADLNRTLQRKSITRHGSLSSRMSRAEPTATMDDMALPPPPPE
LLSDQQKAGYGGSHISGYATLRRGPPPAPPKRDQNTKLSRDW
Download sequence
Identical sequences H2R678
ENSPTRP00000048840 XP_009442329.2.37143 XP_016805839.1.37143 XP_016805840.1.37143 XP_016805841.1.37143 ENSPTRP00000048840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]