SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_016807995.1.37143 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016807995.1.37143
Domain Number 1 Region: 47-142
Classification Level Classification E-value
Superfamily Immunoglobulin 1.11e-18
Family I set domains 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_016807995.1.37143
Sequence length 409
Comment PREDICTED: microfi brillar-associated protein 3-like isoform X3 [Pan troglodytes]; AA=GCF_000001515.7; RF=representative genome; TAX=9598; STAX=9598; NAME=Pan troglodytes; AL=Chromosome; RT=Major
Sequence
MDRLKSHLTVCFLPSVPFLILVSTLATAKSVTNSTLNGTNVVLGSVPVIIARTDHIIVKE
GNSALINCSVYGIPDPQFKWYNSIGKLLKEEEDEKERGGGKWQMHDSGLLNITKVSFSDR
GKYTCVASNIYGTVNNTVTLRVIFTSGDMGVYYMVVCLVAFTIVMVLNITRLCMMSSHLK
KTEKAINEFFRTEGAEKLQKAFEIAKRIPIITSAKTLELAKVTQFKTMEFARYIEELARS
VPLPPLIMNCRTIMEEIMEVVGLEEQGQNFVRHTPEGQEATDRDEVYTIPNSLKRSDSPA
ADSDASSLHEQPQQIAIKVSVHPQSKKEHADDQEGGQFEVKDVEETELSAEHSPETAEPS
TDVTSTELTSEEPTPVEVPDKVLPPAYLEATEPAVTHDKNTCIIYESHV
Download sequence
Identical sequences H2QQF2
9598.ENSPTRP00000028473 ENSPTRP00000028473 ENSPTRP00000028473 XP_008973514.1.60992 XP_008973515.1.60992 XP_016807993.1.37143 XP_016807994.1.37143 XP_016807995.1.37143 XP_016807996.1.37143 XP_016807997.1.37143 XP_016807998.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]