SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_016808911.1.37143 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016808911.1.37143
Domain Number 1 Region: 157-353
Classification Level Classification E-value
Superfamily RNI-like 4.71e-37
Family Cyclin A/CDK2-associated p19, Skp2 0.00000000592
Further Details:      
 
Domain Number 2 Region: 89-143
Classification Level Classification E-value
Superfamily F-box domain 2.75e-16
Family F-box domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_016808911.1.37143
Sequence length 410
Comment PREDICTED: S-phase kinase-associated protein 2 isoform X2 [Pan troglodytes]; AA=GCF_000001515.7; RF=representative genome; TAX=9598; STAX=9598; NAME=Pan troglodytes; AL=Chromosome; RT=Major
Sequence
MHRKHLQEIPDLSSNVATSFTWGWDSSKTSELLSGMGVSALEKEEPDSENIPQELLSNLG
HPESPPRKRLKSKGSDKDFVIVRRPKLNRENFPGVSWDSLPDELLLGIFSCLCLPELLKV
SGVCKRWYRLASDESLWQTLDLTGKNLHPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSP
FRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGC
SGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKS
DLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSRCYDIIPETLLLVTRAG
VRIRLDSDIGCPQTYRTSKLKSSHKLFCQHVRVICIFVCDFYFYRLVLKQ
Download sequence
Identical sequences K7BZX2
ENSP00000274254 NP_116026.1.87134 NP_116026.1.92137 XP_016808911.1.37143 ENSP00000274254 gi|14249170|ref|NP_116026.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]