SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_016811886.1.37143 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016811886.1.37143
Domain Number 1 Region: 39-146
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-31
Family Spermadhesin, CUB domain 0.00037
Further Details:      
 
Domain Number 2 Region: 152-343
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000000633
Family Pentraxin (pentaxin) 0.0049
Further Details:      
 
Domain Number 3 Region: 859-1139
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000000000412
Family Rhodopsin-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_016811886.1.37143
Sequence length 1249
Comment PREDICTED: G-protein coupled receptor 126 isoform X4 [Pan troglodytes]; AA=GCF_000001515.7; RF=representative genome; TAX=9598; STAX=9598; NAME=Pan troglodytes; AL=Chromosome; RT=Major
Sequence
MFRSDRMWSCHWKWKPSPLLFLFALYIMCVPHSVWGCANCRVVLSNPSGTFTSPCYPNDY
PNSQACMWTLRAPTGYIIQITFNDFDIEEAPNCIYDSLSLDNGESQTKFCGATAKGLSFN
SSANEMHVSFSSDFSIQKKGFNASYIRVAVSLRNQKVILPQTSDAYQVSVAKSISIPELS
AFTLCFEATKVGHEDSDWTAFSYSNASFTQLLSFGKAKSGYFLSISDSKCLLNNALPVKE
KEDIFAESFEQLCLVWNNSLGSIGVNFKRNYETVPCDSTISKVIPGNGKLLLGSNQNEIV
SLKGDIYNFRLWNFTMNAKILSNLSCNVKGNVVDWQNDFWNIPNLALKAESNLSCGSYLI
PLPAAELASCADLGTLCQATVNSPSTTPPTVTTNMPVTNRIDKQRNDGIIYRISVVIQNI
LRHPEVKVQSKVAEWLNSTFQNWNYTVYVVNISFHLSAGEDKIKVKRSLEDEPRLVLWAL
LVYNATNNTNLEGKIIQQKLLKNNESLDEGLRLHTVNVRQLSHCLAMEEPKGYYWPSIQP
SEYVLPCLDKPGFSASRTCFYNATNPLVTYWGPVDISNCLKEANEVANQILNLTADGQNL
TSANITNIVEQVKRIVNKEENIDITLGSTLMNIFSNILSSSDSDLLESSSEALKTIDELA
FKIDLNSTSHVNITTRNLALGVSSLLPGTNAISNFSIGLPSNNESYFQMDFESGQVDPLA
SVILPPNLLENLSQEDSVLVRRAQFTFFNKTGLFQDVGPQRKTLVSYVMACSIGNITIQN
LKDPVQIKIKHTRTQEVHHPICAFWDLNKNKSFGGWNTSGCVAHRDSDASETVCLCNHFT
HFGVLMDLPRSASQLDARNTKVLTFISYIGCGISAIFSAATLLTYVAFEKLRRDYPSKIL
MNLSTALLFLNLLFLLDGWITSFNVDGLCIAVAVLLHFFLLATFTWMGLEAIHMYIALVK
VFNTYIRRYILKFCIIGWGLPALVVSVVLASRNNNEVYGKESYGKEKGDEFCWIQDPVIF
YVTCAGYFGVMFFLNIAMFIVVMVQICGRNGKRSNRTLREEVLRNLRSVVSLTFLLGMTW
GFAFFAWGPLNIPFMYLFSIFNSLQGLFIFIFHCAMKENVQKQWRRHLCCGRFRLADNSD
WSKTATNIIKKSSDNLGKSLSSSSIGSNSTYLTSKSKSSSTTYFKRNSHTDNASMDKSLS
KLAHADGDQTSIIPVHQVIDKVKGYCNAHSDNFYKNIIMSDTFSHSTKF
Download sequence
Identical sequences A0A2I3T5K2
9598.ENSPTRP00000042713 ENSPTRP00000042713 XP_016811886.1.37143 ENSPTRP00000042713

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]