SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_016829898.1.69978 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016829898.1.69978
Domain Number 1 Region: 259-316
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.6e-25
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 2 Region: 147-204
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.81e-24
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 3 Region: 539-596
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.55e-23
Family Classic zinc finger, C2H2 0.009
Further Details:      
 
Domain Number 4 Region: 427-484
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.56e-22
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 5 Region: 483-540
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.13e-22
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 6 Region: 203-260
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.02e-21
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 7 Region: 91-148
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.69e-20
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 8 Region: 315-372
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.29e-20
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 9 Region: 371-428
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.31e-19
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 10 Region: 585-636
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.74e-18
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 
Domain Number 11 Region: 57-105
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000197
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 12 Region: 1-33
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000275
Family KRAB domain (Kruppel-associated box) 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_016829898.1.69978
Sequence length 642
Comment PREDICTED: zinc finger protein 431-like isoform X1 [Cricetulus griseus]; AA=GCF_000223135.1; RF=representative genome; TAX=10029; STAX=10029; NAME=Cricetulus griseus; AL=Scaffold; RT=Major
Sequence
MDTSQKNLYKEVMRDTYRNLTDIGYNWEDNNIEEPDQISTQHGRHEKIQSEEESSQYIRC
GKAFECHSYLQMQKRTHTREKSFEYTQCGKVFASHSYLQIHERIHTGEKPYKCNQCDKGF
SHCRSLQHHKKTHIGEKLYQCNQCDKAFTQQSNLRVHERTHTGEKPYECNRCGKAFAYCS
NLQRHERTHTGKKPYKCNQCDKAFTQHSGLKHHKRTHSGEKPYECTLCGKCFAQHSYLRH
HNRTHIGEKPYQCNQCDKAFTQQSNLRVHERTHTGEKPYECNQCGKAFAYCQNLKIHERR
HTGEKPYKCDQCDKAFAHHSSLQHHKITHAGEKHYICNQCGKAFARHDNFQQHKRTHTGQ
KPYKCNQCDKAFGHHNSLQRHKRIHNGEKSYKCNQCGKRFVNTRYLQVHKRTHTGKKSYT
CNQCDKVFAYHGSLKKHKKTHSGEKPYKCNQCDKAFARHDNLQQHKRTHTGEKPYKCNQC
EKAFARQSSMSIHKRTHSGEKPYKCNQCDKAFAHCSTLQDHKRTHNGEKPYKCNQCGKAF
SRQSALQIHKRIHSGEKCYKCNQCDKAFVQPSSLQNHKRTHTGEKPYKCNQCDKAFVQPN
SLQRHKRTHTGEKPYKCNQCDKDFPQKRHFQIHKRTCTGEKP
Download sequence
Identical sequences XP_016829898.1.69978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]