SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_016846689.1.98722 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016846689.1.98722
Domain Number 1 Region: 281-527
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.36e-62
Family Nuclear receptor ligand-binding domain 0.0000000049
Further Details:      
 
Domain Number 2 Region: 175-254
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.89e-26
Family Nuclear receptor 0.0000202
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_016846689.1.98722
Sequence length 555
Comment PREDICTED: estrogen receptor beta [Anolis carolinensis]; AA=GCF_000090745.1; RF=representative genome; TAX=28377; STAX=28377; NAME=Anolis carolinensis; AL=Chromosome; RT=Major
Sequence
MSLCASSHKECSHLLPSLQDHGCSKTEVKSSLSELGSPAIPFSCSPSALTVEHSPIYIPS
SYMENRHDYSAMAFYTPAAMMNYNIPGNFSDSESTALRQTASPSMLWSGPGHISPLTLHC
QSSVLYAEQPKSPWCEARPMDHVLPMHREVLKRKASGSDCTSPTTNSPSSKRDAHFCAVC
SDYASGYHYGVWSCEGCKAFFKRSIQGHNDYICPATNQCTIDKNRRKSCQACRLRKCYEV
GMMKCGSRRERCGYRIIRRHRNSEDSLHCVSKVKKTNETIIQMKEVLVNTLTPEQFVSIL
LEAEPPNVLVSRPNKPFTEASMMMSLTKLADKELVHMIGWAKKIPGFIELSLYDQVRLLE
SCWLEVLMVGLMWRSIDHPGKLIFAPDLVLDRDEGKCVEGILEIFDMLLATTSRLRELKL
QHKEYLCVKAMILLNSSMFPLPSTTEEPESHRKLNHLLNSVTDALVWVIAKSGIPLPQQT
TRLANLLMLLSHVRHASNKGMEHLLSMKCKNVVPVYDLLLEMLNAHTVRNHRKTPISNLE
ISPSEQTETTDGMQL
Download sequence
Identical sequences G1KRR5
XP_016846689.1.98722 ENSACAP00000015597

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]