SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_016852644.1.98722 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016852644.1.98722
Domain Number 1 Region: 264-320
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.09e-22
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 2 Region: 432-488
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.5e-22
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 3 Region: 376-432
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.78e-21
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 4 Region: 488-544
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.46e-21
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 5 Region: 544-600
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.91e-21
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 6 Region: 320-376
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.37e-21
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 7 Region: 208-264
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.7e-20
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 8 Region: 169-221
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.73e-18
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 9 Region: 589-641
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.96e-18
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 10 Region: 20-63
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000000379
Family KRAB domain (Kruppel-associated box) 0.0036
Further Details:      
 
Domain Number 11 Region: 100-126
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000967
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 12 Region: 65-114
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000856
Family Classic zinc finger, C2H2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_016852644.1.98722
Sequence length 646
Comment PREDICTED: zinc finger protein 345-like [Anolis carolinensis]; AA=GCF_000090745.1; RF=representative genome; TAX=28377; STAX=28377; NAME=Anolis carolinensis; AL=Chromosome; RT=Major
Sequence
MMLLPNPQSFLPLCDGVELNQGPIAFEDVAVHFSPEEWALLNPDQKVLHVQVMEEINGIV
DSLVDNGEKSQVCTKCRKHLGHNRGFHTHQQTQNEDEDSTSEKPYKCNVCGQCFPQNVAL
VLHKTYDAGTSHHKWKISAKCVVDYKLPDLCQQEIFEGNNDFMSKECEKPYKCKECGKCF
VQSSSLVSHQRVHTGENLYSCPYCGKCFPSSSSLVKHKRLHTGEKSFQCQECGNCFSCSS
ALAKHKRLHTGEKPYQCQECGKCFVYSSQLLSHRRDHTGEEPYQCQECGKGFANSSNLLR
HKRLHTGEKPYQCQECGKCFVQSSSLVSHQRVHTEENPYSCTDCGKCVSSSPSLVRHKRL
HTGEKPYQCQECGKCFADSSALVSHQRLHTGENPYQCQECGKRFAFSSCLVRHERLHRGE
KPYQCQECGKCFAESSNLLRHKRLHTGEKPYQCQECGKCFASNSCLVRHKRLHTGEKPYQ
CQECGKCFAASSDLVSHKRLHTEENPYQCQECGKCFASSSGLVRHKRFHTGEKPYQCQEC
GKCFPYSSGLVSHKRLHTGEKPYKCQDCGKCFADGSAMLRHKRLHTGEKPFQCQECGKCF
SSSSYLVNHKRLHTGEKPYQCQECGECFARSSYLVNHKRLHTGEKP
Download sequence
Identical sequences XP_016852644.1.98722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]