SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_016867342.1.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016867342.1.92137
Domain Number 1 Region: 374-683
Classification Level Classification E-value
Superfamily RNI-like 5.69e-45
Family 28-residue LRR 0.025
Further Details:      
 
Domain Number 2 Region: 183-474
Classification Level Classification E-value
Superfamily RNI-like 3.14e-33
Family Cyclin A/CDK2-associated p19, Skp2 0.0072
Further Details:      
 
Domain Number 3 Region: 156-195
Classification Level Classification E-value
Superfamily F-box domain 0.0000327
Family F-box domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_016867342.1.92137
Sequence length 735
Comment PREDICTED: F-box/LRR-repeat protein 13 isoform X9 [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MTPELMIKACSFYTGHLVKTHFCTWRDIARTNENVVLAEKMNRAVTCYNFRLQKSVFHHW
HSYMEDQKEKLKNILLRIQQIIYCHKLTIILTKWRNTARHKSKKKEDELILKHELQLKKW
KNRLILKRAAAEESNFPERSSSEVFLVDETLKCDISLLPERAILQIFFYLSLKDVIICGQ
VNHAWMLMTQLNSLWNAIDFSSVKNVIPDKYIVSTLQRWRLNVLRLNFRGCLLRPKTFRS
VSHCRNLQELNVSDCPTFTDESMRHISEGCPGVLCLNLSNTTITNRTMRLLPRHFHNLQN
LSLAYCRRFTDKGLQYLNLGNGCHKLIYLDLSGCTQISVQGFRYIANSCTGIMHLTINDM
PTLTDNCVKALVEKCSRITSLVFTGAPHISDCTFRALSACKLRKIRFEGNKRVTDASFKF
IDKNYPNLSHIYMADCKGITDSSLRSLSPLKQLTVLNLANCVRIGDMGLKQFLDGPASMR
IRELNLSNCVRLSDASVMKLSERCPNLNYLSLRNCEHLTAQGIGYIVNIFSLVSIDLSGT
DISNEGLNVLSRHKKLKELSVSECYRITDDGIQAFCKSSLILEHLDVSYCSQLSDMIIKA
LAIYCINLTSLSIAGCPKITDSAMEMLSAKCHYLHILDISGCVLLTDQILEDLQIGCKQL
RILKMQYCTNISKKAAQRMSSKVQQQEYNTNDPPRWFGYDREGNPVTELDNITSSKGALE
LTVKKSTYSSEDQAA
Download sequence
Identical sequences Q8NEE6
ENSP00000368607 ENSP00000321927 ENSP00000388608 gi|161333852|ref|NP_659469.3| NP_659469.3.87134 NP_659469.3.92137 XP_005250266.1.92137 XP_011514232.1.92137 XP_016867342.1.92137 9606.ENSP00000321927 ENSP00000321927 ENSP00000388608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]