SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_016867668.1.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016867668.1.92137
Domain Number 1 Region: 143-386
Classification Level Classification E-value
Superfamily vWA-like 4e-77
Family Integrin A (or I) domain 0.000000549
Further Details:      
 
Domain Number 2 Region: 387-473
Classification Level Classification E-value
Superfamily Integrin domains 1.52e-20
Family Integrin domains 0.0013
Further Details:      
 
Domain Number 3 Region: 44-102
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000157
Family Plexin repeat 0.00072
Further Details:      
 
Domain Number 4 Region: 591-630
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000276
Family Integrin beta EGF-like domains 0.0056
Further Details:      
 
Domain Number 5 Region: 547-585
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000586
Family Integrin beta EGF-like domains 0.051
Further Details:      
 
Weak hits

Sequence:  XP_016867668.1.92137
Domain Number - Region: 510-547
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00206
Family Integrin beta EGF-like domains 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_016867668.1.92137
Sequence length 769
Comment PREDICTED: integrin beta-8 isoform X1 [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MCGSALAFFTAAFVCLQNDRRGPASFLWAAWVFSLVLGLGQGEDNRCASSNAASCARCLA
LGPECGWCVQEDFISGGSRSERCDIVSNLISKGCSVDSIEYPSVHVIIPTENEINTQVTP
GEVSIQLRPGAEANFMLKVHPLKKYPVDLYYLVDVSASMHNNIEKLNSVGNDLSRKMAFF
SRDFRLGFGSYVDKTVSPYISIHPERIHNQCSDYNLDCMPPHGYIHVLSLTENITEFEKA
VHRQKISGNIDTPEGGFDAMLQAAVCESHIGWRKEAKRLLLVMTDQTSHLALDSKLAGIV
VPNDGNCHLKNNVYVKSTTMEHPSLGQLSEKLIDNNINVIFAVQGKQFHWYKDLLPLLPG
TIAGEIESKAANLNNLVVEAYQKLISEVKVQVENQVQGIYFNITAICPDGSRKPGMEGCR
NVTSNDEVLFNVTVTMKKCDVTGGKNYAIIKPIGFNETAKIHIHRNCSCQCEDNRGPKGK
CVDETFLDSKCFQCDENKCHFDEDQFSSESCKSHKDQPVCSGRGVCVCGKCSCHKIKLGK
VYGKYCEKDDFSCPYHHGNLCAGHGECEAGRCQCFSGWEGDRCQCPSAAAQHCVNSKGQV
CSGRGTCVCGRCECTDPRSIGRFCEHCPTCYTACKENWNCMQCLHPHNLSQAILDQCKTS
CALMEQQHYVDQTSECFSSPSYLRIFFIIFIVTFLIGLLKVLIIRQVILQWNSNKIKSSS
DYRVSASKKDKLILQSVCTRAVTYRREKPEEIKMDISKLNAHETFRCNF
Download sequence
Identical sequences P26012
ENSP00000222573 gi|4504779|ref|NP_002205.1| ENSP00000222573 9606.ENSP00000222573 NP_002205.1.87134 NP_002205.1.92137 XP_016867667.1.92137 XP_016867668.1.92137 ENSP00000222573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]