SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_016871769.1.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016871769.1.92137
Domain Number 1 Region: 81-155
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 8.24e-20
Family HLH, helix-loop-helix DNA-binding domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_016871769.1.92137
Sequence length 214
Comment PREDICTED: neurogenin-3 isoform X1 [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MTPQPSGAPTVQVTRETERSFPRASEDEVTCPTSAPPSPTRTRGNCAEAEEGGCRGAPRK
LRARRGGRSRPKSELALSKQRRSRRKKANDRERNRMHNLNSALDALRGVLPTFPDDAKLT
KIETLRFAHNYIWALTQTLRIADHSLYALEPPAPHCGELGSPGGSPGDWGSLYSPVSQAG
SLSPAASLEERPGLLGATFSACLSPGSLAFSDFL
Download sequence
Identical sequences Q9Y4Z2
9606.ENSP00000242462 gi|68989258|ref|NP_066279.2| ENSP00000242462 ENSP00000242462 NP_066279.2.87134 NP_066279.2.92137 XP_016871769.1.92137 ENSP00000242462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]