SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_016880376.1.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016880376.1.92137
Domain Number 1 Region: 44-131
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 7.32e-37
Family SCAN domain 0.0000545
Further Details:      
 
Domain Number 2 Region: 461-517
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.72e-26
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 3 Region: 657-713
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.23e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 4 Region: 405-461
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.15e-25
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 5 Region: 600-657
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.05e-25
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 6 Region: 544-601
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.2e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 7 Region: 702-754
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.4e-20
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 8 Region: 165-224
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.32e-19
Family KRAB domain (Kruppel-associated box) 0.002
Further Details:      
 
Domain Number 9 Region: 348-405
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.03e-17
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 10 Region: 507-539
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000234
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_016880376.1.92137
Sequence length 761
Comment PREDICTED: zinc finger protein 287 isoform X1 [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MLASSKRMNSSSRSQILLRWKSDKAQSGPYNVEKEILTSRFLRDTETCRQNFRNFPYPDL
AGPRKALSQLRELCLKWLRPEIHSKEQILELLVLEQFLTILPGEVRTWVKSQYPESSEEA
VTLVEDLTQILEEEAPQNSTLSQDTPEEDPRGKHAFQTGWLNDLVTKESMTFKDVAVDIT
QEDWELMRPVQKELYKTVTLQNYWNMVSLGLTVYRPTVIPILEEPWMVIKEILEGPSPEW
ETKAQACTPVEDMSKLTKEETHTIKLEDSYDYDDRLERRGKGGFWKIHTDERGFSLKSVL
SQEYDPTEECLSKYDIYRNNFEKHSNLIVQFDTQLDNKTSVYNEGRATFNHVSYGIVHRK
ILPGEKPYKCNVCGKKFRKYPSLLKHQSTHAKEKSYECEECGKEFRHISSLIAHQRMHTG
EKPYECHQCGKAFSQRAHLTIHQRIHTGEKPYKCDDCGKDFSQRAHLTIHQRTHTGEKPY
KCLECGKTFSHSSSLINHQRVHTGEKPYICNECGKTFSQSTHLLQHQKIHTGKKPYKCNE
CWKVFSQSTYLIRHQRIHSGEKCYKCNECGKAFAHSSTLIQHQTTHTGEKSYICNICGKA
FSQSANLTQHHRTHTGEKPYKCSVCGKAFSQSVHLTQHQRIHNGEKPFKCNICGKAYRQG
ANLTQHQRIHTGEKPYKCNECGKAFIYSSSLNQHQRTHTGERPYKCNECDKDFSQRTCLI
QHQRIHTGEKPYACRICGKTFTQSTNLIQHQRVHTGAKHRN
Download sequence
Identical sequences ENSP00000379168 ENSP00000379169 9606.ENSP00000379168 NP_065704.2.87134 NP_065704.2.92137 XP_011522270.1.92137 XP_016880376.1.92137 ENSP00000379168 ENSP00000379169 ENSP00000379168 gi|194328783|ref|NP_065704.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]