SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_016891209.1.100486 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016891209.1.100486
Domain Number 1 Region: 29-510
Classification Level Classification E-value
Superfamily Sema domain 3.53e-99
Family Sema domain 0.001
Further Details:      
 
Domain Number 2 Region: 854-945
Classification Level Classification E-value
Superfamily E set domains 0.000000000000023
Family Other IPT/TIG domains 0.036
Further Details:      
 
Domain Number 3 Region: 1037-1120
Classification Level Classification E-value
Superfamily E set domains 0.000000000000658
Family E-set domains of sugar-utilizing enzymes 0.032
Further Details:      
 
Domain Number 4 Region: 1371-1495,1531-1556
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.00000000000126
Family p120GAP domain-like 0.021
Further Details:      
 
Domain Number 5 Region: 945-1037
Classification Level Classification E-value
Superfamily E set domains 0.000000000012
Family Other IPT/TIG domains 0.04
Further Details:      
 
Domain Number 6 Region: 508-550
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000124
Family Plexin repeat 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_016891209.1.100486
Sequence length 1651
Comment PREDICTED: plexin-D1 [Cynoglossus semilaevis]; AA=GCF_000523025.1; RF=representative genome; TAX=244447; STAX=244447; NAME=Cynoglossus semilaevis; AL=Chromosome; RT=Major
Sequence
MSPSEVIVLQLLGVLALETRSSSSALLIQYAFSSPNHTNNFVVDPVSGRVYMATVNSVYQ
LNGTLSPEVETRTGPVQDNLLCHAPQLPQAPCEHPKSLTDNYNKLLELDGEQGVVVLCGS
VYQGFCELRKSDNISEIAVEFPPAGEKTVFPSMLNIAANHPNASTVGLIFKSHGGDTRLI
VGATYTGAGTQFFPKNHSKEDLRFENTPEIAIRSLNTKDVSRLFTYDINPSEDNVFKIKQ
EVKSKNKLNFVRAFLHKTYSYIAFNNDAKLGHKESAPNSVLARICLDTENPRKTSGPESR
KLTESYIQLPLQCGTNENIYNRLVSVHAAHIQSEPYLFGVFSKDRQADRKSALCAFKFAD
IEEEIRQGRRNCSNSPSSNVQVLDSVIQGSXXXXXXXXXLQLQPEQLDCGAAHLQHPLAL
RRPLRSRPRFEYPGLTSVSVDNVYNHTVVFLGTSSGRLHKLIFSANMTLGNQWTLKLPAN
EAVHHTMTFDPNDRNFLYLMTSHHMLKVRVAVCDQWRSCSSCLQAGDAHCGWCGLENRCS
LQGACPQQLARSWISVKDGPEECPSITLEPPEISVSADIENVGILMNGSVPDLVGSRVEC
EYGPGVSTVATVHLDSGPTQIQTCPLLPPELFPPIPPGTDHLTVSMAIKVNGTAVVSGSF
VLYDCRRTGAVHPKKSCVSCLSTKWKCFWDQENHRCVSSKEESKNKLLETAASCPSLVAS
EVPPAPSGSAQDFSLSLINVQEGEALECDFGTERRYEATWTNSSTVRCSGVTLSTNQRSQ
VYDLNLRRRGAVGDQGQEVFLDSPQPIRVEVYNCGSGGSDCSQCWGREDQGHRCGWCENS
CRPQSECQPFKDRCPDPPIHKISPLRGPVDGGTLLTVQGRNLGRRAGSVNVTVGDVPCVL
LPEFYTVSVRLVCVTGRSGHPGTDAVQVDVDQSGTGKSKEGFSYLVPKLLSMEPTTGPRA
GGTRVTISGENLDIGSKVVVKVNDTLECSVTQNTVEVLECLMPPALQDNSESVTVCVEFE
DLSCQSTELSTTYTYQKNPVISSIHPEKSYLSGGRTITVTGQGFDLVQTVTMEVLEVGQT
RCSVVSSSSISCSSPPSTLSQQTSVEFLLNGVLYTGDGPFLEEEEPEEQDVRKGHFTLDY
VEDPQFYTANKEKLIKHHPGEPLTLIINKGPSDLELAPEEYSVMIGSYPCNITFSNDQLF
HCTINGRLSSSERELPVTVQVGNFHHTIARVQLGGGELAIVVSIVVCCVLLLLCTVALVV
YCTKSRRAERYWQKTLVQMEEMESQIREEIRKGFAELQTDMTDLTXQTNSSSPAPVLLPL
QMCSDYEQSFVQPIYSDDPLGPRVQLPETHPLLQDWQNTSSTRPNVEEGITLFSTLLNNK
HFLVTFVHALEQQKDFAVRDRCSLASLLTIALHGKLEYYTSIMKDLLVDLIDASASKNPK
LMLRRTESVVEKMLTNWMSICMYSYLKETVGEPFFLLLCAIKQQINKGSIDAITGKARYT
LNEEWLLRENIEAKPQNINVSFQGCGMDSLSVRVMNTDTVCQVKEKIIEAFYKNLPFSQW
PRSEDVDLGKSFKDSELEVLPHDELMETKKSHRQSHRKKVLPEIYLTRLLSTKVVNALEA
NPTARRTQLHHKFEQVVALVEDNIYECCSEA
Download sequence
Identical sequences XP_016891209.1.100486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]