SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_016932118.1.48971 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016932118.1.48971
Domain Number 1 Region: 634-752
Classification Level Classification E-value
Superfamily Bromodomain 5.23e-32
Family Bromodomain 0.001
Further Details:      
 
Domain Number 2 Region: 507-619
Classification Level Classification E-value
Superfamily Bromodomain 1.7e-30
Family Bromodomain 0.00022
Further Details:      
 
Domain Number 3 Region: 178-295
Classification Level Classification E-value
Superfamily Bromodomain 3.14e-27
Family Bromodomain 0.0014
Further Details:      
 
Domain Number 4 Region: 29-155
Classification Level Classification E-value
Superfamily Bromodomain 7.2e-25
Family Bromodomain 0.0013
Further Details:      
 
Domain Number 5 Region: 367-445
Classification Level Classification E-value
Superfamily Bromodomain 7.2e-19
Family Bromodomain 0.0026
Further Details:      
 
Domain Number 6 Region: 1302-1374
Classification Level Classification E-value
Superfamily HMG-box 0.000000000000013
Family HMG-box 0.0013
Further Details:      
 
Domain Number 7 Region: 761-866
Classification Level Classification E-value
Superfamily Bromodomain 0.0000000017
Family Bromodomain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_016932118.1.48971
Sequence length 1506
Comment PREDICTED: protein polybromo-1-like, partial [Drosophila suzukii]; AA=GCF_000472105.1; RF=representative genome; TAX=28584; STAX=28584; NAME=Drosophila suzukii; AL=Scaffold; RT=Major
Sequence
MLSRKRRASSISSRQDEDPLQLDDSTPEQSPVQQTTTQSARKKRRLDPTELCQQLYDSIR
NIKKEDGSMLCDTFIRAPKRRQEPSYYDVVVNPIDLLKVQQKLKTDSYDDLDDLMADLEL
LIGNAKAFYKPDSCEHQDAVALWQHIQTQRQRIMEANGLAEEEPRARRMSRQVRRMTSST
EPGGDGAADDEYNQYEELFASIMTATDPAGDRAMHRMFQLLPSKKIYPDYYDVIEHPIDL
RLIATKIQMNAYSSLVEMERDLLQMTKNACLFNEPGSQIYKDAKALKRIFTQRRIELETG
KGKLAKRVKSLSSAAIAALKEEVDSSDDEETSKKGEGPMWALFDHLYNAPGTSEHPGVTG
PPLGNSLWKLPVRRFHPEYFELIKRPISMSQIHTKLKKGDYANISDLTADLYLMLDNAKK
AFPPSHRTHKDALKMLKLMNAKLVEESLEEGSDLDDEDTEDMDAEVFATSSQPERRKPGR
PRVNSNSNSNASHTPNNSNSPKSNRIAINAAIKKKILSIQKYLVDYSLGNRRPIEMFMEK
PPRKIYPDYYDIIQNPIDMNTIEHNIRTDRYAAVEDVVSDYRLMFSNCRQYNEEGSNIYE
DANILERALNEKLKEFPGLSDVKKPQQKYSKVGRKLKTALITERLWQFYESVKEYQEPKG
KRQLSLIFTKLPSKNEYPDYYDIIKEPIDMDRIAQKLKQGAYESLDDLAADFLLMLENAC
KYNEPDSQIYKDALVLQQLTLQLKQQLRTERDSLPDVPLAVQELFLSLFTTLYNHQDEEG
RCYSDSLAELPEYDEIGEGPKVRGISLDLVKRRLDKGAYKRLDIYQEDIFACLERARKLS
RTDSDIFQDSIELQTYFIRKRDELCKDTLSSAALSFTLERLLADVEVSRQQKLQQEEQDQ
EQDKEKDEFNAAKGESMTINQQVFSPGDYVYVQMPENKIPSICCIERLWTSPTNEKLMQA
SIFVRPHETYHVTTRKFLEKEVFKSSLSQTISMDKVLGMCYVMNIRDYIKMRPENLPEKD
VFVCESRYNIQGRCFKKLKNWPPVREGSSVKFVPREQPLELKRVMSVFKERLEKHKGELE
ELKLQETMVEKEKPNVSCDPPPNAESSSTYYQQYNTICSGAIKTGDFVYVATQTGKQSVA
QVQQIWEQNGKSYFKGPWLLPPSETTPGLGKQFFRQELLLSTVEEVSPVVGIVGRCAVLE
YAEFISSRPTEIQESDVYICESVYDELKKALRKLVAGNMRKFQHSPAVTEDEIFYFKTPI
KPSKDVKNEINELGMLEDSMDGDTPSLSSDIAAMSSPAPSVNSTPLTSKVKAAKSAKKCL
TGYILYSSEVRKGICQSNPDATFGDISRMVGTEWKNLPSSVKQSWEDRASRQNEETAALR
REMDDAQNSASPSPQVAPETFGQVLTFECQWDKCDFQFEELGDCTEHCMSDATGHIQRHP
QAGVEMEYVCLWRNCPRIKKSTQAFPNVLRLIKHVREVHLSKCGKSIAVADRSKNFVSRR
QKHAQL
Download sequence
Identical sequences XP_016932118.1.48971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]