SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_016932669.1.48971 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016932669.1.48971
Domain Number 1 Region: 29-211
Classification Level Classification E-value
Superfamily RUN domain-like 6.93e-31
Family RUN domain 0.0036
Further Details:      
 
Domain Number 2 Region: 404-496
Classification Level Classification E-value
Superfamily PX domain 1.83e-21
Family PX domain 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_016932669.1.48971
Sequence length 520
Comment PREDICTED: sorting nexin-29 [Drosophila suzukii]; AA=GCF_000472105.1; RF=representative genome; TAX=28584; STAX=28584; NAME=Drosophila suzukii; AL=Scaffold; RT=Major
Sequence
MPENAASSVPTEAGFRNLRCQLSGSTFGQRREDIFRRVQESAHQISLKYNGKELATERDE
SVQELCDSFEELLSYGLRQSASGSSFSAANIIQNMQEIVSGNAIGGSNNNDATFWEFCQS
HLTPHERQRYMDLKQIWTNVGRGRAFIRSTLNERRLHSHVLTWLSDEEQLHRYYTPWSLL
LNDEVAKKLPEILDSLRDVLFALNVDTTELNAPRRLAAIVKEEPIIIAPSPVPVIGRHKN
RPGIAVERPIEGATSTEDLLSALTPIQSVEVQQLLSNDAIEQELATSVDEVTVGPFDPIG
PELEFLKTPLPEIFPQAAPEPDLYEDRSDTSSQWSKSSSSANCVANSQQQAALEEQVNQL
NERCALLETRVAELNLQNRLLIRRLTKQFEETGIDPSSSLCSNFLITIPQVKLAKTQRTG
SHYTYEVHITMRQRLEHWTFFRRYSEFNKLHKTLLKTHPVVSAVEFPPKKHFGNMNLVFV
EERRQQLQIYLLNLVEVLPQVEACKSKAELQKVFPFFRER
Download sequence
Identical sequences DS10_00007706 XP_016932669.1.48971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]