SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_016949997.1.21709 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016949997.1.21709
Domain Number 1 Region: 619-678
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.51e-17
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 2 Region: 138-190
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000443
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 3 Region: 343-395
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000118
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 4 Region: 672-729
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000332
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 477-524
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000523
Family Classic zinc finger, C2H2 0.038
Further Details:      
 
Domain Number 6 Region: 536-586
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000903
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 7 Region: 590-644
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000566
Family Classic zinc finger, C2H2 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_016949997.1.21709
Sequence length 1282
Comment PREDICTED: uncharacterized protein LOC108024539 [Drosophila biarmipes]; AA=GCF_000233415.1; RF=representative genome; TAX=125945; STAX=125945; NAME=Drosophila biarmipes; AL=Scaffold; RT=Major
Sequence
MNNQRYGGIQWIQHHVSAGDSSEVDILESDGGAVPTGEDLDHMAAENLIFMARDGQLSEI
MAANEAGGTVLVTADGTTVAYAESFDDEAQVVTEEVITDDWVQHQGAERVEIAADQIAGI
SSSQELLDMEQDEYTALRPYPCDFCSRRFRKKATLNNHMLAHQNDRPHLCKLCGARFSRR
AELISHFKAHAEAQDAADAEAAAAAADSSSAIKFEHQSQRQLDDHYYEHDWPLYQQHQQQ
QEQEQAQKEMQQHHQIVDEGEVQLVASYPATVAPPAAPSRGRISRLKPKEESSQFIVISE
KPAVAELRQYMEAEASQPVVTTSQPIAVDPPPQPNFPVLDDSKPFVCQQCGLAFAREKAL
ISHTKNHRVDSPFECNQCQEMFWDNNSLQEHQKTHQFEESNSEYDPASAEDSASESENEE
QLYGEFYCYDCGISFHRQDLLRRHAKLHNKQTDQVVGESNSDVTAGGDVEVAKDSAGHSC
STCGKTFPSALEMLAHAEIHARFPPFKCVLCGISFYEEQAIKRHLHTRHPTELKANSCVL
CGKECRDRKALIKHAWDHSREKCHSCSKCGKNFHNKARLKRHMASHRDKSVVCEVCHEEF
PDGRTLSNHRHSHSTTSPGKLFPCHECGKTFGSRSSQQIHVRIHTGERPYGCRYCWKAFA
DGGTLRKHERIHTGEKPYACSVCPRAFNQRVVLREHIRSHHSGLDVARNTYHCTVCSEDL
ASSNDLIQHLIQHSDSNTAKQRQPITGPRKYKRRRKLQPFEIAHMRAEHKDANGEEEEAT
GDGEAEEYASDIDLCDFDVENVDDLFDMAESPKKEKRKRGSTAPKADSKPATNGKAVKPA
QEKSKAKPRYDSTSSQQSDRIWEEKFLQDSQVSLFQIDSLVVVNDTHLQPATPTGLAAPN
TRSGAKQQGKLQAKPGEGAGSLNHSAAASVSTSSASTSSSRSRKKAATNKTANKAPPVSN
SRPRMIHTEKAKMTRGASGESSGSATKKSRSKTYISRTETSNLGLDKTRSSASNIVDDYE
IISPATHPPNQISSSPLHIKQEQEQQQRVQLMYDDNLLIDSALLREKTYDKFNPSMVNDL
DDILRSPLKHERNSRLRFTSESSTTPQFLPEEEQNLIKIEPTSPDLREMVESQQRVTAHG
GSTPSSSSARTSRHLRQITANGTRAGSKRTAGGVASKSSPSPGVAAKKANTATKVSSSSS
SYLGYGVDSYNVNVPASANNADVGSGFFSISEVVSAADAADAAAKAAAAGKTERKSRSFE
CEMCSAIFYDRAQLLEHVHIHI
Download sequence
Identical sequences XP_016949996.1.21709 XP_016949997.1.21709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]