SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_016960925.1.21709 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016960925.1.21709
Domain Number 1 Region: 634-752
Classification Level Classification E-value
Superfamily Bromodomain 3.66e-32
Family Bromodomain 0.001
Further Details:      
 
Domain Number 2 Region: 507-619
Classification Level Classification E-value
Superfamily Bromodomain 1.96e-30
Family Bromodomain 0.00022
Further Details:      
 
Domain Number 3 Region: 190-296
Classification Level Classification E-value
Superfamily Bromodomain 3.27e-27
Family Bromodomain 0.0014
Further Details:      
 
Domain Number 4 Region: 29-155
Classification Level Classification E-value
Superfamily Bromodomain 4.06e-24
Family Bromodomain 0.0016
Further Details:      
 
Domain Number 5 Region: 367-445
Classification Level Classification E-value
Superfamily Bromodomain 1.83e-18
Family Bromodomain 0.0025
Further Details:      
 
Domain Number 6 Region: 1303-1374
Classification Level Classification E-value
Superfamily HMG-box 0.0000000000000327
Family HMG-box 0.0014
Further Details:      
 
Domain Number 7 Region: 761-866
Classification Level Classification E-value
Superfamily Bromodomain 0.000000000667
Family Bromodomain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_016960925.1.21709
Sequence length 1657
Comment PREDICTED: protein polybromo-1 [Drosophila biarmipes]; AA=GCF_000233415.1; RF=representative genome; TAX=125945; STAX=125945; NAME=Drosophila biarmipes; AL=Scaffold; RT=Major
Sequence
MLSRKRRASSISSRQDEDPLQLDDSTPEQSPVQQTTTQSARKKRRLDPSELCQQLYDSIR
NIKKEDGSMLCDTFIRVPKRRQEPSYYDVVVNPIDLLKVQQKLKTDSYDDLDDLMADLEL
LIGNAKAFYKTDSCEHQDAVALWQHIQAQRQRIMEANGLAEEEPRARRMSRQVRRMTSCT
EPGGDGAADDEYNQYEELFASIMTATDPASDRAMHRMFQLLPSKKIYPDYYDVIEHPIDL
RLIATKIQMNAYSSLVEMERDLLQMTKNACLFNEPGSQIYKDAKALKRIFTQRRIELEAG
KGKLAKRVKSLSSAAIAALKEEVDSSDDEETSKKGEGPMWALFDHLYNAPGTSEHPGVTG
PPLGNSLWKLPVRRFHPEYFELIKRPISMSQIHTKLKKGDYANISDLTADLYLMLDNAKK
AFSPSHRTHKDALKMLKLMNAKLVEESLEEGSDLDDEDTEDMDAEVFATSSQPERRKPGR
PRVNSNSNSNASHTPNNSNSPKSNRIAINAAIKKKILSIQKYLVDYSLGNRRPIEMFMEK
PPRKIYPDYYDIIQNPIDMNTIEHNIRTDRYAAVEDVVSDYRLMFSNCRQYNEEGSNIYE
DANILERALNEKLKEFPGLSDVKKPQQKYNKVGRKLKTALITERLWQFYESVKEYQEPKG
KRQLSLIFTKLPSKNEYPDYYDIIKEPIDMDRIAQKLKQGAYESLDDLAADFLLMLENAC
KYNEPDSQIYKDALVLQQLTLQLKQQLRSERDSLPDVPLAVQELFLTLFTTLYNHQDEEG
RCYSDSLAELPEYDEIGEGPKVRGISLDLIKRRLDKGAYKRLDIYQEDIFACLERARKLS
RTDSDIFQDSIELQTYFIRKRDELCKDTLSSPALSFTLERLLADVEVSRQQKLQQEEQDQ
EQDKEKDEFNGAKGESMTINQQVFSPGDYVYVQMPENKIPSICCIERLWTSPTNEKLMQA
SIFVRPHETYHVTTRKFLEKEVFKSSLSQTISMDKVMGMCYVMNIKDYIKMRPENLPEKD
VFVCESRYNIQGRCFKKLKNWPPVREGSSVKFVPRDQPLELKRVMSVFKERLEKHKGELE
ELKLQETMVEKEKPNVSCDPPPNADSTSTYYQQYNTVCSGAIKTGDFVYVATQTGKQSVA
QVQQIWEQNGKSYFKGPWLLPPSETNPGLGKQFFRQELLLSTVEEVSPVVGIVGRCAVLE
YAEFITSRPTEIPESDVYICESVYDELKKAIRKLVAGNMRKFQHSPAVTEDEIFYFKSPI
KPSKDVKNELNELGMLEDSMDGDTPSLSSDIAAMSSPAPSVNSTPLTSKAKAAKSAKKCL
TGYILYSSEVRKGICQSNPEATFGDISRMVGTEWKNLPASVKQSWEDRASRQNEETAAMR
REFDDAQNSASPSPQVTQETFGQVLTFECQWDKCDFQFEELGDCTEHCMSDATGHIQRHP
QAGVEMEYVCLWRNCPRIKKSVQAFPNVLRLIKHVREVHLSKCGKSIAPGDRSKNFVSRR
QKHTQLATTVPIPPSLAQSPRAPNNLEAVQLQQQQQQQNAHQLQQLQQQQQTIVLGPPPE
PLFVTVPPRTTRVIHSEAYIKYIESLQSGSHLNVATCNNNWRRALTHVTPAQVVAKAPLP
EHWIGPNLRDQGNVVQALCHLRNFMVDDVLQIRRSCN
Download sequence
Identical sequences XP_016960925.1.21709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]