SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_016970990.1.97277 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016970990.1.97277
Domain Number 1 Region: 71-520
Classification Level Classification E-value
Superfamily Sema domain 2.62e-133
Family Sema domain 0.0000409
Further Details:      
 
Domain Number 2 Region: 1389-1518,1727-1888
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.28e-43
Family p120GAP domain-like 0.034
Further Details:      
 
Domain Number 3 Region: 882-976
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000255
Family Other IPT/TIG domains 0.0076
Further Details:      
 
Domain Number 4 Region: 975-1063
Classification Level Classification E-value
Superfamily E set domains 0.00000000000204
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.063
Further Details:      
 
Domain Number 5 Region: 523-574
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000654
Family Plexin repeat 0.0021
Further Details:      
 
Domain Number 6 Region: 1082-1164
Classification Level Classification E-value
Superfamily E set domains 0.0000000938
Family E-set domains of sugar-utilizing enzymes 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_016970990.1.97277
Sequence length 1945
Comment PREDICTED: plexin-A2 [Drosophila rhopaloa]; AA=GCF_000236305.1; RF=representative genome; TAX=1041015; STAX=1041015; NAME=Drosophila rhopaloa; AL=Scaffold; RT=Major
Sequence
MILILSLLLIATLGDKHDYWLHSRTGSQTLAANIWSDKPANQNEPINLTDANVTIKDAKN
LSTTITNVAKFDTKLNHLLVDTITGRVFVGGVNRLYQLSPDLELTETVKTGPQNDSVECS
ILDCPLNAVRSPTDNYNKVLLIDRATSRLIACGSLFQGTCTVRNLQNVSIIEHEVPDAVV
ANDANSSTVAFIAPGPPQHPVTNVMYVGVTYTNNSPYRSEIPAVASRSLEKTKMFQIASS
AVTTGTRTFINSYARETYFVNYVYGFSSERFSYFLTTQLKHSHHSSPKEYITKLVRICQE
DSNYYSYTEIPVECISDAQGGTKFNLVQAGYLGKPSSDLAQSLGISIQDDVLFAVFSKGD
GNSPTNNSALCIYSLKSIRRKFMQNIKSCFNGNGMRGLDFISPSMPCVLTKLQTIGEDFC
GLDVNSPLGGENPITSVPVAMFNKKLTSVAATSTSGYTVVFVGTTDGHLKKVVVESSSVA
NEYASFSVDLGSAINQDMQFDNQNLYMYVMSETKVSKVKVFDCTDYKTCGECLGARDPYC
GWCSLENKCSPRSNCQDDANDPLYWVSYKTGKCTTITSVVPHQLQRTTARTLELIIDHLP
QLKENLICAFTTEDKALFTNATKKRNGVNCTTPRTDMLPQIEQGKHHFTAKLSVRTRNGP
DLVSTDFTFFDCSTHSSCTRCVSSEFPCDWCVEAHRCTHDTAENCRNDILVTGVSRIGPS
YRSGPGFCPTINATGDGSEVLVAGGTSKSIKVKVHIIGQFIVQTRFVCQFNIEGRVTSLN
AQLLGDTIYCDSMEFQYTSRSPNLTATFAVIWGGSKPLDNPHNIHVVIYRCREMADSCGI
CLALAEKYNCGWCSSTNTCEVEEQCNKNKEGKTDWLNRSEICPNPEIHTFEPKTGPWEGG
TNITIRGINLGKNYNDIYSGVRIAGINCMPFPQFYIDTKQIVCTVDSPGEQMYRNGKIVV
QIGDYRGESKEDYEFVDPKILDFNPKFGPTSGGTEIHITGKHLNAGSRIQASINDHLPCK
ILSTGSTQAICRTSPSPGIIEGRLKMSFDNGPREFNDYNFKYVLDPTVEHVSSGPSGQIK
VPKGIPAGGIRISVIGTQFTSIQTPNIYVVYNGEIFASQCRVQSDTEMECASPVIGVDSE
IIEAERPMLLEYGFLMDNVLRVQNLSKIHNNHFELYPNPEYFIFEERVKYFKSEYLTING
RNLDRACKETDVEVKIGNGFCNITSLSRQQLTCRPPPEATATKSINGPEVIVRIGTSLEY
RIGILSYESSNIILDWGENVIFAVIATIVILLLIFVALLVAYKKKSSESNRVLRNMQEQM
DILELRVAAECKEAFAELQTEMTDLTGDLTSGGIPFLDYRSYAMKILFPNNEDHIVLQWE
RPELLRKEKGLRIFGQLIMNKTFLLLFIRTLESNRYFSMRERVNVASLIMVTLQSKLEYC
TDILKTLLGDLIEKCIEGKSHPKLLLRRTESVAEKMLSAWFTFLLYKFLKECAGEPLYML
FRAVKGQVDKGPVDACTHEARYSLSEEKLIRQSIDFRPMNVYASIIQQPIFCNNLDMLPS
HTENVPVKVLDCDTIGQVKEKCLETIYKNIPSSQRPRKDDLDLEWRTGATGRVILYDEDV
TSKTESEWKKLNTLQHYNVPDGAGLSLVPKQSSIYNFSILSDKNEKSHKYETLNISKYTS
SSPTFSRAGSPLNNDMHDNGLRYWHLVKHHDSDMQKEGERVNKLVSEIYLTRLLSTKGTL
QKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDDQAQLHGITDPEVVHTWKSNSLPLRFW
VNLIKNPNFVFDIHKSNIVDSCLSVVAQTFMDSCSTSDHRLGKDSPSSKLLYAKDIPEYR
KWVDRYYRDIRDMSPISDQDMNAMLAEESRLHTTEFNTNCALHELYTYAVKYNEQLTVTL
EEDEFSQKQRLAFKLEQVHNIMSAE
Download sequence
Identical sequences XP_016970990.1.97277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]