SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_016978268.1.97277 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016978268.1.97277
Domain Number 1 Region: 616-675
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.86e-17
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 2 Region: 138-190
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000443
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 3 Region: 340-392
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000145
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 4 Region: 669-726
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000036
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 533-583
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000101
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 6 Region: 474-521
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000206
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 7 Region: 587-641
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000025
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_016978268.1.97277
Sequence length 1275
Comment PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC108043959 [Drosophila rhopaloa]; AA=GCF_000236305.1; RF=representative genome; TAX=1041015; STAX=1041015; NAME=Drosophila rhopaloa; AL=Scaffold; RT=Major
Sequence
MNNQRYGGIQWIQHHVSAGDSSEVDILENDGGAGATGEDLDHMAAENLIFMARDGQLSEM
MAANEAGGTVLVTADGTTVAYAESFDDDAQVVTEEVITDDWVQHQGAERVEIAAEQIAGI
SSSQELLDMEQDEYTALRPYPCDFCSRRFRKKATLNNHMLAHQNDRPHLCKLCGARFSRR
AELISHFKAHAEAQDAADAEAAAAAADSTSSIKFEHQSQRQLDDHYYEQEWPLYQQQQEQ
DQSQQEMQHHHQILEVGEVQLLDSYPEAVAPPAAPTRGRISRLKPKEESSQFIVISDKPI
ASDLRDYMDSEPAQPVVATSHPIAVEPPPQPNFPVLDDSKPFVCQQCGLAFAREKALVSH
TKNHRVDSPFECNQCQEMFWDNTSLQEHQKTHQFEESNSEYDPASAEDSASESEPEEQLY
GEFYCNECGISFHRQDLLRRHAKMHCKQTDQAAGEGNSDVTAGGEIELAKDSGGHCCHTC
GKSFPSALEMLAHAEIHARFPPFKCVLCGISFYEEQAIKRHLHTRHPSELKANSCVLCGK
ECRDRKALIKHAWDHSREKCHSCSKCGKNFHNKARLKRHMASHRDKSVVCEVCQEEFPDG
RTLSNHRHSHSTTSPGKLFPCHECGKTFGSRSSQQIHVRIHTGERPYGCRYCWKAFADGG
TLRKHERIHTGEKPYACSVCPRAFNQRVVLREHIRSHHSGLDVARNTYHCTVCSEDLASS
NDLIQHLIQHSDSNTAKQRQPITGPRKYKRRRKLQPHEIAHMRAEHKDANGEEEDAIGGG
DADEYTSDIDLCDFDVENVDDIFEMAESPKKEKRKRSSGAPKAEPKPAANGKTVKSAQEK
NKAKSRYDSTSSQQSDRIWEEKFLQDSQVALFQIDSLVVVNDTHLQPSSSTGSAAVPKTR
GAAKQQGKVQAKPAEVADNLNTSVSTSTGASTTSSSRSRKKAGTTKTASKAPPAINSRPR
MIHTEKAKVPKGAGGESSSSAAKKTRSKTYISRTETTNLSLEKSRSSASNMVDDYEIISP
ATHPPNQISSSPLHIKQEQEQRVQLMYDDNLLIDAGLLREKTYEKFNPSIVNLEEILRSP
LKHERNSRLRFTSESSTTPQFLPEEEQNLIKIEPTSPDLREMVESQQRVTAPSGTTPSSS
SSARTSRHLRQITANGARTESRRTAGGITSKSIAGPGVAKKVNTATKVSSSSSSYLNYGV
DAYNVNVPASTSNVDVGSGFFSISEVVSAADAADAAAMAAAAGKLERKSRSFECEMCSAI
FYDRAQLLEHVHIHI
Download sequence
Identical sequences XP_016978268.1.97277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]