SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_016981946.1.97277 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016981946.1.97277
Domain Number 1 Region: 640-750
Classification Level Classification E-value
Superfamily Bromodomain 1.83e-31
Family Bromodomain 0.001
Further Details:      
 
Domain Number 2 Region: 506-619
Classification Level Classification E-value
Superfamily Bromodomain 1.22e-30
Family Bromodomain 0.00021
Further Details:      
 
Domain Number 3 Region: 188-294
Classification Level Classification E-value
Superfamily Bromodomain 5.63e-27
Family Bromodomain 0.0014
Further Details:      
 
Domain Number 4 Region: 29-155
Classification Level Classification E-value
Superfamily Bromodomain 8.5e-25
Family Bromodomain 0.0013
Further Details:      
 
Domain Number 5 Region: 364-444
Classification Level Classification E-value
Superfamily Bromodomain 4.06e-19
Family Bromodomain 0.0026
Further Details:      
 
Domain Number 6 Region: 1301-1373
Classification Level Classification E-value
Superfamily HMG-box 0.0000000000000196
Family HMG-box 0.0016
Further Details:      
 
Domain Number 7 Region: 760-865
Classification Level Classification E-value
Superfamily Bromodomain 0.00000000968
Family Bromodomain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_016981946.1.97277
Sequence length 1653
Comment PREDICTED: protein polybromo-1 [Drosophila rhopaloa]; AA=GCF_000236305.1; RF=representative genome; TAX=1041015; STAX=1041015; NAME=Drosophila rhopaloa; AL=Scaffold; RT=Major
Sequence
MLSRKRRASSISSRQDEDPLQLDDSTPEQSPVQQTTTQSARKKRRLDPTELCQQLYDSIR
NIKKEDGSMLCDTFIRAPKRRQEPSYYDVVVNPIDLLKVQQKLKTDSYDDLDDLMADLEL
LIGNAKAFYKPDSCEHQDAVSLWQHIQAQRQRIMEANGLAEEEPRARRISRQVRRMTSST
EPGLDGMDDEYNQYEELFASIMTASDPVGDRAMHRMFQLLPSKKIYPDYYDVIEHPIDLR
LIATKIQMNAYSSLVEMERDLLQMTKNACLFNEPGSQIYKDAKALKRIFTQRRIELETGK
GKLAKRIKSLSSAAIAALKEEVDSSDDEETSKKGEGPMWALFDHLYNAPGTSEHPGVTGP
PLGNFLWKLPVRRFHPEYFELIKRPISMSQIHTKLKKGDYANISDLTADLYLMLDNAKKA
FPPSHRTHKDALKMLKLMNAKLVEESLEETSDLDEEDADDIETEVFTANSQPERRKPGRP
RVNSNSNSNASHTPNNSNSPKTNRIAINAAIKKKILSIQKYLVDYSLGNRRPIEMFMEKP
PRKIYPDYYDIIQNPIDMNTIEHNIRTDRYAAVEDVVSDYRLMFSNCRQYNEEGSNIYED
ANTLERALNEKLKEFPGLVEVKKTQQKYSKVGRKLKTALITDRLWQFYETVREYQEPKGK
RQLSLIFTKLPSKNEYPDYYDIIKEPIDMERIAQKLKQGAYESLDDLAADFLLMLENACK
YNEPDSQIYKDALVLQQLTLQLKQQLRTERDSLPDVPLAVQELFLTLFTTLYNHQDEEGR
CYSDSLAELPEYDEQGEGPKVRGISLDLVKRRLDKGAYKRLDIYQEDIFACLERARKLSR
TDSDIFQDSIELQTYFIRKRDELCKDTLSSPALTFTLERLLSDVEVSRQQKAQQEEQDQE
QEKEKDEFNAAKGESMTINQQVFSPGDYVYVQMPENKIPSIASIERLWTSPTNEKLMQAS
IFVRPHETYHVTTRKFLEKEVFKSGLSQTISMDKVLGMCYVMNIRDYIKMRPEKLPEKDV
FVCESRYNIQGRCFKKLKNWPPNREGSSVKFVPREQPLELKRVMSVFKERLEKHKGELEE
LKLQETLVEKEKPNVSCDPPLNAENNSTYYQQYNTVCSGAIKTGDFVYVATQTGKQSVAQ
VQQIWEQNGKSYFKGPWLLPPSETTPGLGKQFFRQELLLSTVEEVSPVVGVVGRCAVLEY
AEFISSRPTEISESDVYICESVYDELKKALRKLAAGSLRKFQHSPAVTEDEIFYFKTPIK
PSKDVKNEINELGMLEDSMDGDTPSLSSDIAAMSSPAPSVNSTPLTSKVKAAKSAKKCLT
GYILYSSEVRKGICQSNPEASFGDISRMVGTEWKNLPSSVKQSWEDRASRQNEETAAMRR
ELDDAQNSASPSPQVSQDGSSQVLTFECQWDKCDFQFEELGDCTEHCMSDATGHIQRNPQ
AGVEIEYICLWRNCPRIKKSTQAFPNVLRLTKHVREVHLSKCGKPVAVADRSKNFVPRRP
KHASLATTVPIPPSLAQSPRGPTNLDAVQIQQQQQHNVHQQQQMQQQTIVLGPPPEPLFV
TVPPRTTRVIHSEAYIKYIESLQTGSHLNVATCNNSWRRALTHVTPAQVVAKAPLPEQWI
GPNLRDQGNVVQALCHLRNFMVDDVLQIRRSCN
Download sequence
Identical sequences XP_016981946.1.97277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]