SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_016992402.1.47939 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016992402.1.47939
Domain Number 1 Region: 486-648
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 8.63e-65
Family A middle domain of Talin 1 0.0000401
Further Details:      
 
Domain Number 2 Region: 657-779
Classification Level Classification E-value
Superfamily I/LWEQ domain 9.22e-52
Family I/LWEQ domain 0.0000716
Further Details:      
 
Domain Number 3 Region: 2278-2470
Classification Level Classification E-value
Superfamily I/LWEQ domain 2.35e-51
Family I/LWEQ domain 0.00012
Further Details:      
 
Domain Number 4 Region: 749-885
Classification Level Classification E-value
Superfamily I/LWEQ domain 2.55e-43
Family I/LWEQ domain 0.00017
Further Details:      
 
Domain Number 5 Region: 1214-1350
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 9.42e-35
Family VBS domain 0.02
Further Details:      
 
Domain Number 6 Region: 1830-1961
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 5.96e-34
Family VBS domain 0.00041
Further Details:      
 
Domain Number 7 Region: 203-317
Classification Level Classification E-value
Superfamily Second domain of FERM 1.96e-29
Family Second domain of FERM 0.00000966
Further Details:      
 
Domain Number 8 Region: 318-408
Classification Level Classification E-value
Superfamily PH domain-like 1.72e-25
Family Third domain of FERM 0.0000575
Further Details:      
 
Domain Number 9 Region: 1072-1197
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0000000345
Family alpha-catenin/vinculin 0.024
Further Details:      
 
Domain Number 10 Region: 1996-2120
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.00000129
Family VBS domain 0.013
Further Details:      
 
Domain Number 11 Region: 941-1041
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.00000765
Family I/LWEQ domain 0.0045
Further Details:      
 
Domain Number 12 Region: 1456-1541
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0000353
Family I/LWEQ domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_016992402.1.47939
Sequence length 2817
Comment PREDICTED: talin-2 isoform X2 [Drosophila takahashii]; AA=GCF_000224235.1; RF=representative genome; TAX=29030; STAX=29030; NAME=Drosophila takahashii; AL=Scaffold; RT=Major
Sequence
MSTLSLRIQLEGGRVTKTIQFQPNTTVFDACKVIRDKFAEAVQGQPSEYGLFISDEQNQQ
GVWLEPGRTLGYYILHNQDTLEYRRKTRTLRVRMLDGAVKTILVDDSQPVSQLMVVICTK
IGITNHEEYGLVREDNEAQNENLPDNKFGTLTLKRKIMEKDRDAKMESLRKKLKTDDEMN
WVDVSRTLREQGIDEAETVLLRRRFFFSDQNIDSRDPVQLNLLYVQARDAILDGTHPVTQ
DKACEFAGIQVHIQFGPHNEAKHKTGFLDLKDFLPQSYVRTKGIEKKIFSEHRKHTDLSE
IDAKVLYTKTARELPTYGVTFFLVKEKMNGKNKLVPRLLGVTKDSVLRLDEHTKEILISW
PLTTVRRWGASPNTFTLDFGDYANQYYSVQTTEAEQIVQLIAGYIDIILKKKQTKDHFGI
EGDEGSTMVEESVAPSKATFLQHETNRMEQLNVESLAHPGIMRPYDASGHPMFYKTKEVR
ISSVNLTEPQRALLGYISAGQDVLIRADEELRTKAPIQELGSDMRSIEWRENTLDTSKQA
VSSHVATMSAATAQIITASHPDEVDTEAISASVSQIAQTIPEVTKEVRLIAALMENDTNG
DQLLEAARNLCNAFSDLLKAAEPESKEPPQHLINAASRVGEATTHVLSTIAEEEVPENRD
LHDMLLALAKAVANTTAALVLRAKNIAASCEDEQARNRVIGAASQCALATSQLVACAKVV
APTLHNAACREQLEAAARNVARAVNSLCEVCNEASNDPKLKADLLAAARDVSKSLTDMLE
HVKLSSRERANRTSTELSPVENVIIGTDILVSTHDPQEMVRHARTLGQTTAQLIQSIKGE
ADQQQDADLKRHLLSAAKQLADATAKLVEAARLCSSNPHDSDNQNALRRAAEELREITTT
AANTPAMKRGLIQRLEFCSKQAASAATQCISAAQNAVQHSQDHQTKETLLQDCKRVADTI
PRLVTSLKTTRAQPDDPNAQLNLIEAAEQFIEPALQVSKSSRALQPTVTDIPSATQLSKG
ALHLGQCVSELHSVAQRARDACGGQELESALEEVRKLHDVLDDTRQAALAGQLRPLPGQT
VESTADELRKSAKNVGIALSQLLSSVLHNQRSYAGAAGRDTALALGDFTRSVHGVAATTQ
NPAIIDCADDVVTSSARLIEQAQRTLQGVSNPEALTQAGREVTGALSATVDCIPGQREVD
VALRNVSDLSEILSMSEFPPSGRPYATLQSELKQVAEQLSSSGGEIVVSYASPALLAESS
QNFAANYRDLLSVSMEMAGQTQEEEVRSQMIESLRHVSTQSCSLLSTAKSIAADPGQPNA
KNLLHAAARGVTESINQLVDASIQSAPGQKECDNAMRNIEALRLMLDYPHEPINELGYFD
CVEQATGKSRNLGYAISEMINNAKQSQHVEFSQSVNNVNDSIQGLIESSSQAAYLIGVSH
PSSVAGRPGIIDQAQLTWAYQGIRQHCDIVSSQQSTKPQMISALTVIAKHTSYLCSICRQ
ASMNTSNPVAKNEFIVLAKQVATATSDLVQAIKAIEEQPASGSRDRLVDPLLEAVKAVRQ
YASSPEFSSVPAKISAEGRKAQEPVIQAGRGVIDGVVEMVKAAKSLALSPDNPPVWQQLS
MHSTPVSESVKRLVDNIRDKAPGQAQCEQVLHTLGTCTRELDSCALAVNAQGLSQRRDNN
LHGFSGQTMNSASELVDKLEPIRVAGKNNAEQLGHTVGEISRYVVPMVNGAIGACTHIVH
SQQQMSLIQQTRSVVESAVTLVQSAKDSAGNPRATHAHPRLDDAIDGTREAIQELQQTVE
KISAETGIVTGLMEQVNRSITRLTDKRQSLLNASYSDTFVDYQTRMVARAKEIASLANEM
NAKSSVEPAALPQLAVDMTQHYQQLTQDSVGASTTTSSPDVAMRIRTTVIDLGRSVSSMI
QSSAGGARPNDVGAQKDIARNAREVSEKVAQVLAALQAGSRGTQACINAAHTVSGIIGDL
DTTIMFATAGTLHSDGDGSFADHREHILQTAKALVEDTKVLVTGAAGTQDQLANAAQNAV
STITQLAEAVKRGACSLGSTQPDSQVMVINAVKDVASALGDLINCTKLASGKPINDPSMQ
GLKESARVMVLNVSSLLKTVKAVEDEHTRGTRAMEATVEAISQEIRAMHTPPPVGNTQVG
PEDLIRVTMNVTAATAKAVAAGTSNLQADIVSAANLGRRAISDMLIVCRSVAWNCAETEE
LRSRTLEAGTAVGESYRDLLSGILHNCSADDRMHLSRRVAKCVTDLVAMARLLKGSDWID
PEDPTVIAENELLGAAASIDAAAKKLASLRPRRQADVKIELDENMKFDEMILEAAKGIMA
ASAALVRAANAAQRELIDTGKVARRPLTSSDDGQWSEGLISAARLVAAATHSLVEAAQNL
VRGVGTEEMLISTAKQVAASTAQLLIACKVKSNPNSEAGRRLQAAGNAVIKSTDNLVRSA
QQGLEAEEEHSLKINTSMVDGMAQEINARSAVLRKEKELEEARQLLKNVRHARRFVKNAQ
GVTTDESDTEYAYRSQDNTLGRSGYYGSGEMPSSPNYLSGGSQQQQKHNYSYASPQPQHF
HHPGAVSPPPSNYPPLDDTNGDFPPPPPPLSTTISNMQTATSGHSFRPNPKLTANAVPRP
YPGSPGGSNGLTSTPNPSGTNTNTNYQQSFESSSTKTLNSSPPAVPKKPTVNRNLAACVQ
DLHDKTFGQGGVVQLTGGNGYPGQNYEGYTSRYETRNFDKSANNTTSSSSELGAVKPLES
SFSQMTLNTDGGKISIVDQGSERLTSMTQRVMERKSFTTTTESRSETKTEKHSFRLD
Download sequence
Identical sequences XP_016992402.1.47939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]