SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_016999013.1.47939 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016999013.1.47939
Domain Number 1 Region: 635-753
Classification Level Classification E-value
Superfamily Bromodomain 1.44e-31
Family Bromodomain 0.001
Further Details:      
 
Domain Number 2 Region: 508-620
Classification Level Classification E-value
Superfamily Bromodomain 2.49e-30
Family Bromodomain 0.00022
Further Details:      
 
Domain Number 3 Region: 186-296
Classification Level Classification E-value
Superfamily Bromodomain 3.79e-27
Family Bromodomain 0.0014
Further Details:      
 
Domain Number 4 Region: 29-155
Classification Level Classification E-value
Superfamily Bromodomain 1.31e-24
Family Bromodomain 0.0013
Further Details:      
 
Domain Number 5 Region: 368-446
Classification Level Classification E-value
Superfamily Bromodomain 8.77e-19
Family Bromodomain 0.0026
Further Details:      
 
Domain Number 6 Region: 1303-1375
Classification Level Classification E-value
Superfamily HMG-box 0.0000000000000106
Family HMG-box 0.0013
Further Details:      
 
Domain Number 7 Region: 762-867
Classification Level Classification E-value
Superfamily Bromodomain 0.00000000196
Family Bromodomain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_016999013.1.47939
Sequence length 1663
Comment PREDICTED: protein polybromo-1 [Drosophila takahashii]; AA=GCF_000224235.1; RF=representative genome; TAX=29030; STAX=29030; NAME=Drosophila takahashii; AL=Scaffold; RT=Major
Sequence
MLSRKRRASSISSRQDEDPLQLDDSTPEQSPVQQTTTQSARKKRRLDPTELCQQLYDSIR
NIKKEDGSMLCDTFIRAPKRRQEPSYYDVVVNPIDLLKVQQKLKTDSYDDLDDLMADLEL
LVGNAKAFYKPDSCEHQDAVALWQHIQVQRQRIMEANGLAEEEPRARRISRQVRRMTSST
EPGGDGGAPDDEYNQYEELFASIMTASDPVGDRAMHRMFQLLPSKKIYPDYYDVIEHPID
LRLIATKIQMNAYSSLVEMERDLLQMTKNACLFNEPGSQIYKDAKALKRIFTQRRIELET
GKGKLAKRVKSLSSAAIAALKEEVDSSDDEETSKKGEGPMWALFDHLYNAPGTSEHPGVT
GPPLGNSLWKLPVRRFHPEYFELIKRPISMSQIHTKLKKGDYANISDLTADLYLMLDNAK
KAFPPSHRTHKDALKMLKLMNAKLVEESLEEGSDLDDEDADDLDAEVFATSSQPERRKPG
RPRVNSNSNSNASHTPNNSNSPKSNRIAINAAIKKKILSIQKYLVDYSLGNRRPIEMFME
KPPRKVYPDYYDIIQNPIDMNTIEHNIRTDRYAAVEDVVSDYRLMFSNCRQYNEEGSNIY
EDANILERALNEKLKEFPGLSDVKKPQQKYSKVGRKLKTALITERLWQFYESVKEYQEPK
GKRQLSLIFTKLPSKNEYPDYYDIIKEPIDMDRIAQKLKQGAYESLDDLSADFLLMLENA
CKYNEPDSQIYKDALVLQQLTLQLKQQLRTERDSLPDVPLAVQELFLSLFTTLYNHQDEE
GRCYSDSLAELPEYDEIGEGPKVRGISLDLVKRRLDKGAYKRLDIYQEDIFACLERARKL
SRTDSDIFQDSIELQTYFIRKRDELCKDTLSSPALSFTLERLLADVEVSRQQKLQQEEQD
QEQDKEKEEFNAAKGESMTINQQVFSPGDYVYVQMPENKIPSICSIERLWTSPTNEKLMQ
ASIFVRPHETYHVTTRKFLEKEVFKSSLSQTISMDKVLGMCYVMNIKDYIKMRPERLPEK
DVFVCESRYNIQGRCFKKLKNWPPVREGSSVKFVPREQPLELKRVMSVFKERLEKHKGEL
EELKLQETMVEKEKPNVSCDPPPNAESSSIYYQQYNTVCSGAIKTGDFVYVATQTGKQSV
AQVQQIWEQNGKSYFKGPWLLPPSETTPGLGKQFFRQELLLSTVEEVSPVVGIVGRCAVL
EYAEFISSRPTEISESDVYICESVYDELKKALRKLVAGNMRKFQHSPAVTEDEIFYFKTP
IKPSKDVKNEMNELGMLEDSMDGDTPSLSSDIAAMSSPAPSVNSTPLTSKVKAAKSAKKC
LTGYILYSSEVRKGICQSNPDATFGDISRMVGTEWKNLPASVKQSWEDRASRQNEETAAM
RRELDDAQNSGSPSPQVSQDAYGQVLTFECQWDKCDFQFEELGDCTEHCMSDGIGHIQRH
PQAGVEMEYVCLWRNCPRIKKSTQAFPNVLRLIKHVREVHLSKCGKSIAPADRSKNFVSR
RQKNASLAGATTVPIPPSLAQSPRAPSNLEAVQLQQQQQQQQQNVHQMQQLQQQQQQTIV
LGPPPEPLFVTVPPRINRVIHSEAYIKYIEGLQTGSHLNVATCSNNWRRALTHVTPAQVV
AKAPLPEQWIGPNLRDQGNVVQALCHLRNFMVDDVLQIRRSCN
Download sequence
Identical sequences XP_016999013.1.47939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]