SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017020564.1.37106 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017020564.1.37106
Domain Number 1 Region: 633-748
Classification Level Classification E-value
Superfamily Bromodomain 2.09e-31
Family Bromodomain 0.0011
Further Details:      
 
Domain Number 2 Region: 508-621
Classification Level Classification E-value
Superfamily Bromodomain 2.75e-31
Family Bromodomain 0.00021
Further Details:      
 
Domain Number 3 Region: 194-298
Classification Level Classification E-value
Superfamily Bromodomain 9.94e-28
Family Bromodomain 0.0014
Further Details:      
 
Domain Number 4 Region: 29-155
Classification Level Classification E-value
Superfamily Bromodomain 4.84e-25
Family Bromodomain 0.0012
Further Details:      
 
Domain Number 5 Region: 368-446
Classification Level Classification E-value
Superfamily Bromodomain 7.98e-18
Family Bromodomain 0.0027
Further Details:      
 
Domain Number 6 Region: 1304-1375
Classification Level Classification E-value
Superfamily HMG-box 0.00000000000000576
Family HMG-box 0.0012
Further Details:      
 
Domain Number 7 Region: 806-868
Classification Level Classification E-value
Superfamily Bromodomain 0.0000000144
Family Bromodomain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_017020564.1.37106
Sequence length 1659
Comment PREDICTED: protein polybromo-1 [Drosophila kikkawai]; AA=GCF_000224215.1; RF=representative genome; TAX=30033; STAX=30033; NAME=Drosophila kikkawai; AL=Scaffold; RT=Major
Sequence
MLSRKRRASSISSRQDEDPLQLDDSTPEQSPVQQTTTQSARKKRRLDPSELCQQLYDSIR
NIKKEDGSMLCDTFIRAPKRRQEPSYYDVVVNPIDLLKVQQKLKTDSYDDLDDLMADLEL
LIGNAKAFYKPDSCEYQDAVSLWQHIQTQRQRILEANGLAEEEPRARRMSRQVRRMTSSM
EPGNDTTATDDEYNQYEELFATIMTATDPVNDRAMHRMFQLLPSKKIYPDYYDVIEHPID
LRLIATKIQMNAYSSLLEMERDLLQMTKNACLFNEPGSQIYKDAKALKRIFTQRRIEMET
GKGKLAKRVKSLSSAAIAALKEEVDSTDDEETSKKGEGPMWALFDHLYNAPGTSEHPGVT
GPPLGNSLWKLPVRRFHPEYFELIKRPISMSQIHTKLKKGDYANISDLTADLYLMLDNAK
KAFPASHRTHKDALKMLRLMNAKLVEESLEETSDLEEDEADDVDSEVFAVSTQPERRKPG
RPRVNSNSNSNASHTPNNSNSPKSNRIAINAAIKKKILSIQKYLVDYSVGNRRPIEMFME
KPPRKVYPDYYDIIQNPIDMNTIEHNIRTDRYATVEDVVSDYRLMFSNCRQYNEEGSNIY
EDANTLERALNEKLKEFPGLVEVKKPLQKYSKVGRKPKIAVISDRLWQFYETVREYQEPK
GKRQLSLIFTKLPSKNEYPDYYDIIKEPIDMERIAQKLKQGAYESLDELAADFLLMLENA
CKYNEPDSQIYKDALVLQQLTLQLKQQLRIERDSLPDVPLAVQELFLTLFTTLYNHQDEE
GRCYSDSLAELPEYDELGEGHKVRGISLDLIKRRLDKGAYKRLDIYQEDIFACLERARKL
SRTDSDIFQDSIELQTYFIRKRDEICKDTLSSPALSFTLERLLADVEVSRQQKAQQEEQD
QEQDKEKDEFNGAKGESMTINQQVYSPGDYVYVQMPENKIPSIASIERLWTSPTNEKLMQ
ASIFVRPHETYHVTTRKFLEKEVFKSSISQTISMDKVLGMCYVMNIKDYIKMRPERLPEK
DVFVCESRYNIQARCFKKLKSWPPMREGSSIKFVPREQPLELKRVMSVFKERLEKHKGEL
EELKLQETLVEKEKPNVSCDPPPNAEDSSVYYQQYNTVCSGAIKTGDFVYVATQTGKQSV
AQVQQIWEQNGKSYFKGPWLLPPSETTPGLGKQFFRQELLLSTVEEVSPVVGIVGRCAVL
EYAEFINSRPTEISESDVYICESVYDELKKALRKLVAGNMRKFQHSPAVTEDEIFYFKTP
IKPAKDVKNEINELGMLEDSMDGDTPSLSSDIAAMSSPAPSVNSTPLTSKIKAAKSAKKC
LTGYILYSSEVRKSICQSNPDATFGDISRMVGTEWKNLPSSAKQSWEDRASRQNEETAAM
RRELDDAQNSASPSPQVSQDGQGLIFECQWDKCDYQFEELGDCTEHCMSDASGHIQRHPQ
AGVEMEYVCLWRNCPRIKKSTQAFPNVLRLVKHVREVHLSKCGKQLSAGERSKNFVSRRH
KNATLATTVPIPSSNSQSPRGPNNHEASMHLQHQQQHHHQQQQQLMHQHPQQQTIVLGPP
PEPLFVTVPPRTTRVIHSEAYIKYIESLQTGSHLNVATCQNNWRRAMTHVTPAQVVAKAP
LPEHWLGPNLRDQENVVQALCHLRNFMLDDVLQIRRSCN
Download sequence
Identical sequences XP_017020564.1.37106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]