SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_017026774.1.37106 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017026774.1.37106
Domain Number 1 Region: 649-708
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.43e-17
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 2 Region: 151-203
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000323
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 3 Region: 368-420
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000764
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 4 Region: 702-759
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000036
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 504-554
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000497
Family Classic zinc finger, C2H2 0.026
Further Details:      
 
Domain Number 6 Region: 566-616
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000101
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 7 Region: 620-674
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000265
Family Classic zinc finger, C2H2 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_017026774.1.37106
Sequence length 1323
Comment PREDICTED: zinc finger protein 646 [Drosophila kikkawai]; AA=GCF_000224215.1; RF=representative genome; TAX=30033; STAX=30033; NAME=Drosophila kikkawai; AL=Scaffold; RT=Major
Sequence
MNNQDYGGIQWIQHHPAAGDSSETDIMEHEDADGDDMVSGADGDPDGDGDADVDLDHMAA
ENLIFMARDGQLGEIIAANEGTVLVTADGTTVAYAESFDDDAQVVTEEVITDDWVQHQGA
ERVEIAAEQIAGISSSQELLDMEQDEYTALRPYPCDFCSRRFRKKASLNNHMLAHQNDRP
HLCKLCGARFSRRAELISHFKAHAEAQDAADAEAAAAAAAVSGSSSIKFENQSHRQTDDH
YYEQEWPLYQQQHQQQEQEQQQELGQHEQMLQQEQQQLVCNSEVQFVASYTASVAPPPAP
SRGRISRLKPKEESSQFIVITDKPAPSELRDYMASEPVPQPVVPTSQPMAIDAPPAPQPN
FPVLDDSKPFVCQQCGLAFAREKALVSHTKNHRVDSPFECNQCQEMFWDNSSLQDHQKTH
QFEESNSEYDPASGEDSASETSEPEDQLYGEFYCNECGISFHRQDLLRRHAKQHFKQQDH
HSTVAAGDGSSSDVIASGDQAKEGNDGHCCQTCGKSFPSAAEMLSHAEIHARFPPFKCVL
CGISFYEEQAIKRHLHARHPNELKANSCVLCGKECRDRKALIKHAWDHSREKCHSCSKCG
KNFHNKARLKRHMASHRDKSVVCEVCQEEFPDGRTLSNHRHSHSTTSPGKLFPCHECGKT
FGSRSSQQIHVRIHTGERPYGCRYCWKAFADGGTLRKHERIHTGEKPYACSVCPRAFNQR
VVLREHIRSHHSGLDGARNTYHCTVCSEDLASSNDLIQHLIQHSDSNTAKQRQPVTGPRK
YKRRRKLQPHEIAHMRAEHKDANGGGDEEEILGAEGNGDGDEYASDIDLCDFDVENVDDL
FEMAESSPKKEKRKRASATSVKTEQKPISNGGGSAVKPVQEKNKAKLRYDSTSSQQSDRI
WEEKFLQDSQVSLFQIDSLVVVNDTHLQPASSAAMPKTRGGAKQQQQQAKQPVERASNSN
PSAASSVGTSSASASASTSTSSSRSRKKTAAAKTAAASRPRMIHTEKTKVPAKETAGGEL
AKKTRSKTYITRTETSNLGSLDKSRSRASNIVDDYEIISPATHPPNQISSSPLHIKQEQE
QQHRVPMMYDDNLLIDAALLREKTYEKFNPSIVNDLEEILRSPLKHERNTRLRFTSESST
TPQFLPEEEQNLIKIEPTSPDLREMLESQSQRVRVPSGNTPSTSSSSAARTSRHRMITAS
GPRAGNKRGAGSGSSASKSSPAPGVMAKKVSTAASKVGGSSSYLNYGVDAYNVSVPASAS
TADVGSGFFSISEVVSAADAADAAAKAAAAGKPERKTRSFECEMCSAIFYDRAQLLDHVH
IHI
Download sequence
Identical sequences XP_017026774.1.37106 XP_017026775.1.37106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]