SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017054015.1.74164 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017054015.1.74164
Domain Number 1 Region: 145-456
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 3.66e-112
Family Glutaminase 0.00000708
Further Details:      
 
Domain Number 2 Region: 481-566
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000000187
Family Ankyrin repeat 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_017054015.1.74164
Sequence length 697
Comment PREDICTED: glutaminase liver isoform, mitochondrial isoform X12 [Drosophila ficusphila]; AA=GCF_000220665.1; RF=representative genome; TAX=30025; STAX=30025; NAME=Drosophila ficusphila; AL=Scaffold; RT=Major
Sequence
MIVTTILKKLRAPPLLNLVFANRKLSFYDTSSTPKTKEDNAKLHREQEQRNAEDVLFDMF
ASEETGLISMGKFLAGLKTTGIRRNDPRVRELMDNLKKVHKLNNYETGSSAETQHLNRET
FKAVVAPNIVLIAKAFRQQFVIPDFTSFVKDIEDIYNRCKSNTLGKLADYIPQLARYNPD
SWGLSICTVDGQRFSIGDVEVPFTLQSCSKPLTYAIALEKLGPKVVHSYVGQEPSGRNFN
ELVLDQNKKPHNPMINAGAILTCSLMNALVKPDMTSAEIFDYTMSWFKRLSGGEYLGFNN
AVFLSEREAADRNYALGFYMRENKCFPKRTNLKEVMDFYFQCCSMETNCEAMSVIAASLA
NGGICPTTEEKVFRPEVIRDVLSIMHSCGTYDYSGQFAFKVGLPAKSGVSGGMMLVIPNV
MGIFAWSPPLDHLGNTVRGLQFCEELVSMFNFHRYDNLKHLSNKKDPRKHRYETKGLSIV
NLLFSAASGDVTALRRHRLSGMDITLADYDGRTALHLAASEGHLECVKFLLEQCHVPHNP
KDRWGNLPVDEAENFGHSHVVEFLRSWAEKAGQSGEESQPEAVTTKTQADEVSSSPSSSS
SSSPGSSSSPQAINLLGQKPSQSQESQEPKLNSNLTFQEICSTSDLETSPATSPIPTPLD
SGSRAGSGRSSPVPSDAGSTASAGSASSVDDKTKPGL
Download sequence
Identical sequences A0A1W4VCI1
XP_017054015.1.74164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]