SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017058301.1.74164 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017058301.1.74164
Domain Number 1 Region: 635-749
Classification Level Classification E-value
Superfamily Bromodomain 1.7e-31
Family Bromodomain 0.00099
Further Details:      
 
Domain Number 2 Region: 499-616
Classification Level Classification E-value
Superfamily Bromodomain 2.35e-30
Family Bromodomain 0.00022
Further Details:      
 
Domain Number 3 Region: 187-295
Classification Level Classification E-value
Superfamily Bromodomain 2.49e-27
Family Bromodomain 0.0014
Further Details:      
 
Domain Number 4 Region: 29-155
Classification Level Classification E-value
Superfamily Bromodomain 3.92e-25
Family Bromodomain 0.0012
Further Details:      
 
Domain Number 5 Region: 367-445
Classification Level Classification E-value
Superfamily Bromodomain 2.88e-18
Family Bromodomain 0.0027
Further Details:      
 
Domain Number 6 Region: 1299-1371
Classification Level Classification E-value
Superfamily HMG-box 0.00000000000000524
Family HMG-box 0.0015
Further Details:      
 
Domain Number 7 Region: 758-863
Classification Level Classification E-value
Superfamily Bromodomain 0.00000000798
Family Bromodomain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_017058301.1.74164
Sequence length 1649
Comment PREDICTED: protein polybromo-1 [Drosophila ficusphila]; AA=GCF_000220665.1; RF=representative genome; TAX=30025; STAX=30025; NAME=Drosophila ficusphila; AL=Scaffold; RT=Major
Sequence
MLSRKRRASSISSRQDEDPLQLDDSTPEQSPVQQTTTQSARKKRRLDPSELCQQLYDSIR
NIKKEDGSMLCDTFIRAPKRRQEPSYYDVVVNPIDLLKVQQKLKTDSYDDLDDLMADLEL
LIGNAKAFYKPDSCEYQDAVSLWQHIQAQRQRIMEANGLAEEEPRARRMSRQVRRMTSST
EPGGDGAGDDEYNPYEELFASIMTATDPVGDRAMHRMFQLLPSKKIYPDYYDVIEHPIDL
RLIATKIQMNAYSSLVEMERDLLQMTKNACLFNEPGSQIYKDAKALKRIFTQRRIELETG
KGKMAKRIKSLSSSAIAALKEEVDSSDDEETSKKGEGPMWALFDHLYNAPGTSEHPGVTG
PPLGNSLWKLPVRRFHPEYFELIKRPISMSQVHTKLKKGDYANISDLTADLYLMLDNAKK
AFPPSHRTHKDALKMLKLMNAKLVEESLVETSDLDEEDADDIDAEVFISSQPERRKPGRP
RINSNSNSSHTPNNSNSPKNNRIAINAAIKKKILSIQKYLVDYSLGNRRPIEMFMEKPPR
KVYPDYYDIIQNPIDMNTIEHNIRTDRYAAVEDVVSDYRLMFSNCRQYNEEGSNIYEDAN
ILERALNEKLKEFPGLSEVKKQQQKYSKVGRKLKTALITERLWQFYSTVREYQEPKGKRQ
LSLIFTKLPSKSEYPDYYDIIKEPIDMERIAQKLKQGVYESLDDLAADFLLMLENACKYN
EPDSQIYKDALMLQQLTLQLKQQLRTERDSLPDVPLAVQELFLTLFTTLYNHQDEEGRCY
SDSLAELPEYDELGEGPKMRGISLDLVKRRLDKGAYKRLDVYQEDIFACLERARKLSRTD
SDVFQDSIELQTYFIRKRDELCKDTLSSPALNFTLERLLADVEVSRQQKLQQEEQDQEQE
KDKDEFNAAKGESMTINQQVFSPGDYVYVQMPENKIPSIACIERLWTSPTNEKLMQASIF
VRPHETYHVTTRKFLEKEVFKSSLSQTISMDKVLGMCYVMNIKDYIKMRPEKLPEKDVFV
CESRYNIQARCFKKLKNWPPVREGSSVKFVPREQPLELKRVMSVFKERLEKHKGELEELK
LQETLVEKEKPNVSCDPPPNAENSCVYYQQYNTVCSGAIKTGDFVYVATQTGKQSVAQVQ
QIWEENGKSYFKGPWLLPPSETTPGLGKQFYRQELLLSTVEEVSPVVGIVGRCAVLEYSE
FISSRPTEISESDVYICESVYDEMKKALRKLVSGNLRKFHHSSAVTEDEIFYFKTPIKPS
KDVKSEINELGMLEDSMDGDTPSLSSDIAPMSSPAPSVNSTPLTSKMKAAKSAKKCLTGY
ILYSSEVRKSICQSNPEASFGDISRMVGTEWKNLPSSVKQSWEDRASRQNEETAAMRREL
DDTHNSASPSPQVSQDATGQVLTFECQWDKCDFQFEELGDCTEHCMSDATGHIQRHPQAG
MELEYVCLWRNCPRIKKSVQAFPNVLRLIKHVREVHLSKCGKQVAVCDRSKNFVPRRQKH
QQLATMVPIPPGLAQSPRGSNNLEAVQLQQQQQNVHQQQMQQQTIVLGPPPEPLFVTVPP
RTTRVIHSEAYIKYIESLQTGSHLNVATCNNNWRRALTHVTPAQVVAKAPLPEQWIGPNL
RDQNNVVQALCHLRNFMVDDVLQIRRSCN
Download sequence
Identical sequences A0A1W4W1F8
XP_017058301.1.74164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]