SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017062030.1.74164 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017062030.1.74164
Domain Number 1 Region: 77-528
Classification Level Classification E-value
Superfamily Sema domain 4.45e-121
Family Sema domain 0.0000241
Further Details:      
 
Domain Number 2 Region: 1487-1612,1823-1974
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.4e-41
Family p120GAP domain-like 0.03
Further Details:      
 
Domain Number 3 Region: 880-969
Classification Level Classification E-value
Superfamily E set domains 0.000000000000764
Family Other IPT/TIG domains 0.043
Further Details:      
 
Domain Number 4 Region: 530-581
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000051
Family Plexin repeat 0.0025
Further Details:      
 
Domain Number 5 Region: 1087-1157
Classification Level Classification E-value
Superfamily E set domains 0.0000000000127
Family E-set domains of sugar-utilizing enzymes 0.076
Further Details:      
 
Domain Number 6 Region: 970-1047
Classification Level Classification E-value
Superfamily E set domains 0.00000000588
Family Other IPT/TIG domains 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_017062030.1.74164
Sequence length 2043
Comment PREDICTED: plexin-B isoform X1 [Drosophila ficusphila]; AA=GCF_000220665.1; RF=representative genome; TAX=30025; STAX=30025; NAME=Drosophila ficusphila; AL=Scaffold; RT=Major
Sequence
MKRTDNYCVDFKHVFYRLSIIALLSLRLHSVDCVKEMPAQGFFPSNDIVAQFYLPSISTT
SKSNNGNRSTETGGISQTKNYFTHLSFDHKHNVLFAGATNKILKLNENLRVLSEAVTGPV
NDSPQCHAGGCPEDIETSLVNNYNKILVVSYANDGILISCGSIRQGACEIYSLPRFPSTP
QFFAVPLAANDEIASTYAFVGPARYSWKEEDILYVGTTFTNVGDYRHDVPAISSRRLDDL
NYAEFSIQQSIINIDVKYRDHFLVDYVYGFNSSEYAYFIIVQKKSHLADEAGYVTRLARI
CITDPNYDSYTEITVQCTATENNIDYNILRDAKLTPASQKLAQKMGIKKDDHVLVTVFSP
SKEISNQPESKSAMCIYSIKDIEDVFIENIHLCFNGTIKDRNLGYISGTINDGRCPVVGS
LGNIYNFCSVGLKISGVSPITSHALFHFENVSVTSVTATSTTDQQHSLAFLGTDMGVIKK
VLLSGQSPGEYEEIVVDAGNRILPNTMMSPKKDFLYVLSDRKITKLRIEHCSVYTNCSAC
LESRDPFCGWCSLEKRCTVRSTCQRDTSASRWLSLGSGQQCIEFEAIIPEKIPITELTHL
HLIIRTLPEPFNAKYRCVFGNSTPIDAEILDNGLGCATPPLDERPEIPTNTDHVLVPLSV
RSSETNKDFVSRYFAFFDCSHHGNCQECVQSSWGCNWCVFDNKCVHKTSPCRSIENAINA
VGQCPHLKNNHPAILLPVRVPKEIRLEIENLPKPKSAHAGFLCTIHIEAAQMLLPAHIES
NKIVVCEKTPYFYETNTHEYQAKVVVTWNFQHYVDTATITLYKCDVLGSHRDHADCSLCV
TRDPKYKCSWCSNSCVYNETCMEDKNSINGGSKLALENECPLPRIDIIKPLSGPIEGGTL
ITIEGSNLGIREADVRGKIFIGTVPCELVSYQISVKIECRTTATMYEMSAPIKVANDAGY
TESSVQFHFKNVMLTGLYPSIGPRSGGTQLSIIGKFLNIGSTMRAFLDEYECYINFTQAS
STQVSCTTSEATQPEPIRSLHLIIDGANRTLECQNSALSTTNKNPSRSNFGHQFRTPLRQ
PCSIFNYTQDPRIMQIKPLRSFVSGGRVLTVHGIYLDSIQKPELEVFFDNERVNKTSCVV
VTSNQMECPSPPVNYKFQTFKNASRMLNSELDFKNASLTTENWFSHRQKRRSDFMDNFHI
YTTGETSPSYLAENNMDVTTFVKVHETQLNLQLSFVMDNVQLVRDLTKYFHDIRSTIVYL
ADPKFLPFPKDGIKLYKGDSLVIEGELLNLAADEYDVNVTIGTAQCNITSLALTQLLCIP
PEHQPLPTDENGIDQSLELPLVVVKVGRNLRFVIGYLKYDLNKPYVFSHALFVVLLTVAI
LVIFLVIVLIIFRRKSTQAEREYKRIQIQMITLESNVRSECKQAFAELQTDMTDLTADLE
STGIPTLDHVNYIMKVFFPGVSDHPILNSEKFRGNSPHTNYDAAMVQFEQLIGNKYFLLM
FIETLEAQRSSFSIRDRVNVASLLMIVLMNKMEYATEILKSLLLRLIDKSLASKHPQLML
RRTESVVEKMLTNYLAICMYDYLKEYAGSNLFLLFKAIKHQIEKGLVDAITNDARYSLSE
ERLLHEQITHSVVMLHILQDDLDEKVQCRVNDWDTISQVKLKILDAIFKNTPFSMRPSVH
EVDLEWRHGRGGHLTLQDEDLTTKTVNGWKRLNTLAHYGVKESAVMSLIARQSDNYHIPY
GKNQNHAPYHNFYFINNSQSHIIMNNDIESGLQQPRLYHLVKPVIPDHYMNIKNSVLSGA
SPALQSSHCVNNCNDRVNKTIPEVYLTRLLATKGTIQKFVDDFFSIILTVNEELPPAVKW
LFDLLDEAARRHDIADTDIVHAWKSNCLPLRFWVNFIKNPDFIFDVNKTFCVDSCLSVIA
QTFMDACSTAEHRLGKDSPSNKLLFAKDIPHYRIMVKEFYRDVSKLPQISDQEMSTAMQQ
LSIRQNEEFDTISALKELYIYITKYKGQIMEALESDINCRKMQLSRKLENVAGTLDGDGI
SNC
Download sequence
Identical sequences A0A1W4W125
XP_017062030.1.74164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]