SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017085535.1.81094 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017085535.1.81094
Domain Number 1 Region: 639-752
Classification Level Classification E-value
Superfamily Bromodomain 1.14e-31
Family Bromodomain 0.001
Further Details:      
 
Domain Number 2 Region: 507-618
Classification Level Classification E-value
Superfamily Bromodomain 2.09e-30
Family Bromodomain 0.00022
Further Details:      
 
Domain Number 3 Region: 181-295
Classification Level Classification E-value
Superfamily Bromodomain 5.23e-27
Family Bromodomain 0.0014
Further Details:      
 
Domain Number 4 Region: 29-155
Classification Level Classification E-value
Superfamily Bromodomain 8.77e-25
Family Bromodomain 0.0015
Further Details:      
 
Domain Number 5 Region: 367-445
Classification Level Classification E-value
Superfamily Bromodomain 1.23e-17
Family Bromodomain 0.0027
Further Details:      
 
Domain Number 6 Region: 1303-1374
Classification Level Classification E-value
Superfamily HMG-box 0.0000000000000301
Family HMG-box 0.0015
Further Details:      
 
Domain Number 7 Region: 761-866
Classification Level Classification E-value
Superfamily Bromodomain 0.00000000183
Family Bromodomain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_017085535.1.81094
Sequence length 1652
Comment PREDICTED: protein polybromo-1 [Drosophila eugracilis]; AA=GCF_000236325.1; RF=representative genome; TAX=29029; STAX=29029; NAME=Drosophila eugracilis; AL=Scaffold; RT=Major
Sequence
MLSRKRRASSISSRQDEDPLQLDDSTPEQSPVQQTTTQSARKKRRLDPTELCQQLYDSIR
NIKKEDGSMLCDTFIRVPKRRQEPSYYDVVVNPIDLLKVQQKLKTDSYDDLDDLMADLEL
LIGNAKAFYKSDSFEYQDAVSLWQQIQSQRQRIMEANGLAEEEPRARRISRQVRRMTTST
EPGGDGAADDEYNQYEELFASVMTASDPVGDRAMHRMFQLLPSKKIYPDYYDVIEHPIDL
RLIATKIQMNAYSSLVEMERDLLQMTKNACLFNEPGSQIYKDAKALKRIFTQRRIELETG
KGKLAKRIKSLSSAAIAALKEEVDSSDDEETSKKGEGPMWALFDHLYNAPGTSEHPGVTG
PPLGNSLWKLPVRRFHPEYFELIKRPISMSQIHTKLKKGDYANISDLTADLYLMLDNAKK
AFPLSHRTHKDALKMLKLMNAKLVEESLEEGSDLDEEEADEMDAEVFTPSSQPEKRKPGR
PRINSNSNSNASHTPNNSNSPKSNRIAINAAIKKKILSIQKYLVDYSLGNRRPIEMFMEK
PPRKIYPDYYDIIQNPIDMNTIEHNIRTDRYAAVEDVVSDYRLMFSNCRQYNEEGSNIYE
DANILERALNEKLKEFPGLSEGKKTQQKYNKVGRKLKTALITDRLWQFYETVKEYQEPKG
KRQLSLIFTKLPSKNEYPDYYDIIKEPIDMDRIAQKLKQGAYESLDDLAADFLLMLENAC
KYNEPDSQIYKDALVLQQLTLQLKQQLRTERDSLPDVPLAVQELFLTLFTTLYNHQDEEG
RCYSDSLAELPEYDEIGEGPKVRGISLDLVKRRLDKGAYKRLDIYQEDIFACLERARKLS
RTDSDIFQDSIELQTYFIRKRDELCKDTLSSPALSFTLERLLADVEVSRQQKVQQEEQDQ
EQDKEKDEFNAAKGESMTINQQVFSPGDYVYVQMPENKIPSICCIERLWTSPTNEKLMQA
SIFVRPHETYHVTTRKFLEKEVFKSSLSQTISMDKVLGMCYVMNIKDYIKMRPDRLPEKD
VFVCESRYNIHGRCFKKLKSWPPIREGSSVKFVPREQPLELKRVMSVFKERLEKHKGELE
ELKLQETLVEKEKPNVSCDPPQNSESTSTYYQQYNTVCSGAIKTGDFVYVATQTGKQSVA
QVHQIWEENGKSYFKGPWLLPPSETTPGLGKQFFRQELLLSTVEEVSPVVGIVGRCAVLE
YAEFITSRPTEISESDVYICDSVYDELKKALRKLSPGNMRKFKHSPAVTEDEIFYFKTPI
KPSKDVKNELNELAMLEDSMDGDTPSLSSDIAAMSSPAPSVNSTPLTSKFKAAKSAKKCL
TGYILYSSEVRKGICQSNPEATFGDISRMVGTEWKNLPASVKQSWEDRASRQNEETAAMR
RELDDAQNSASPLPQMSQDAFGQVLTFECQWDKCDFQFEELGDCTEHCMSDATGHIQRHP
QAGVEMEYVCLWRNCPRIKKSIQAFPNVLRLIKHVREVHLSKCGKSVSMADRSKNFVPRR
QKNAPLATTVPIPPSLAQSPRAPSNLEAVQLQQQQQQHNVHQLQQQQIVLGPPPEPMFVT
VPPRTTRVIHSEAYIKYIESLHTGSHLNVATCNNNWRRALTHVTPAQVVAKAPLPEQWIG
PNLRDQGNVVQALCHLRNFMVDDVLQIRRSCN
Download sequence
Identical sequences XP_017085535.1.81094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]