SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017098393.1.53830 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017098393.1.53830
Domain Number 1 Region: 372-594
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.66e-53
Family DBL homology domain (DH-domain) 0.0002
Further Details:      
 
Domain Number 2 Region: 67-185
Classification Level Classification E-value
Superfamily BRCT domain 1.6e-20
Family DNA topoisomerase II binding protein 1, TopBP1 0.06
Further Details:      
 
Domain Number 3 Region: 204-288
Classification Level Classification E-value
Superfamily BRCT domain 0.000000000000064
Family DNA topoisomerase II binding protein 1, TopBP1 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_017098393.1.53830
Sequence length 851
Comment PREDICTED: protein ECT2 isoform X3 [Drosophila bipectinata]; AA=GCF_000236285.1; RF=representative genome; TAX=42026; STAX=42026; NAME=Drosophila bipectinata; AL=Scaffold; RT=Major
Sequence
METIEEQSKCEMSISTTLASRICLVGEVGKDAETLQAAESFGLPIVTSETGLDILGEAEW
RTFYVLDDFEGASFEAIHKQKECILGPPALKYAAEMKQTLGQNSRPIYNYAMRGVVTCFT
GIRKKDELTKLVNLIHSMGGCIKKDLNTKTTHLICNHSGGEKYQYAKTFRLTVVRPAWVY
AAWSDRNSLEFDATQETFTKTHRLKAFEGQKICFFGFPPEEHQHMVDVLLENGGVCAELE
DPECSHVVVDEHTTVSKPEPKNNHTHILKSDWFWYTIQNGYANEMDYLFGDYLDSITNTP
NTDRRDSLPISFNKRKRKRFSQRIQLEGTPLGSGKRRSSVSDAGLLSVSNSFFDCTTSPD
KLEVDKLHHAEPEASDATPAKKSMRFNHFMDFFTTESNYVGILDTILNLFKNKLEELAET
NDPLLNKSEIKTIFGNFLPIHEVHQSMLEHLRKLHANWREDCLIGDIIIQHRDELIKAYP
PYVNFFEQMKEQLLYCDREYPRFHAFLKINQTKPECGRQSLQDLMIRPVQRLPSISLLLN
DILKHTNGSNADHGRLEEALKAIKQVTLHINEDKRRTESRMAIFDIFNDIDGCPPHLVSS
NRSFISKCEVNELSDSLSGRGDSLVVYLFSDSMELCKRRSRGFNTAKSPSTAKTHKHLKL
ISLNTIRLVIDISDSPRAFGLLQRGEKEKLYTFTISDEETDKHVYVKKLCNQIAAHTCRT
DADKLLISRTSQELEVDISDVNVSTLSKAFKLAAKTRLKVGRAFSFNKTPNKLKRAVSTM
MTSPFGSTNSLTPASQLAQMRLASCTNINEVDDEDCASMRSSSPSTQSEMLVVPPLSVQP
TRKNKAVVGRI
Download sequence
Identical sequences XP_017098393.1.53830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]