SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017104981.1.53830 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017104981.1.53830
Domain Number 1 Region: 625-749
Classification Level Classification E-value
Superfamily Bromodomain 6.8e-32
Family Bromodomain 0.0011
Further Details:      
 
Domain Number 2 Region: 504-617
Classification Level Classification E-value
Superfamily Bromodomain 8.77e-31
Family Bromodomain 0.00021
Further Details:      
 
Domain Number 3 Region: 193-294
Classification Level Classification E-value
Superfamily Bromodomain 4.84e-27
Family Bromodomain 0.0014
Further Details:      
 
Domain Number 4 Region: 29-155
Classification Level Classification E-value
Superfamily Bromodomain 3.53e-24
Family Bromodomain 0.0014
Further Details:      
 
Domain Number 5 Region: 365-443
Classification Level Classification E-value
Superfamily Bromodomain 2.49e-18
Family Bromodomain 0.0025
Further Details:      
 
Domain Number 6 Region: 1299-1371
Classification Level Classification E-value
Superfamily HMG-box 5.37e-16
Family HMG-box 0.0013
Further Details:      
 
Domain Number 7 Region: 758-863
Classification Level Classification E-value
Superfamily Bromodomain 0.00000000445
Family Bromodomain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_017104981.1.53830
Sequence length 1649
Comment PREDICTED: protein polybromo-1 [Drosophila bipectinata]; AA=GCF_000236285.1; RF=representative genome; TAX=42026; STAX=42026; NAME=Drosophila bipectinata; AL=Scaffold; RT=Major
Sequence
MLSRKRRASSISSRQDEDPLQLDDSTPEQSPVQQTTTQSARKKRRLDPAELCQQLYDSIR
NIKKEDGSMLCDTFIRAPKRRQEPSYYEVVENPIDLLKVQQKLKTDSYDDLDDLMADLAL
LIGNAKAFYKQESMEHQDAVSLWQHIQSQRQRILEANGLAEEEPRSKRISRQVRRLTSSV
EPGGDGDDECNQYEELFASVMTATDPMGDRAMHRMFQLLPSKKIYPDYYDVIEHPIDLRL
IATKIQMNAYSSLVEMERDLLQMTKNACLFNEPGSQIYKDAKALKRIFTQRRIELESGKG
KMSRRIKSLSSAAIAALKEEVDSSDDEETSKKGEGPMWALFDHLYNAPGTSEHPGVTGPP
LGNSLWKLPVRRFHPEYFELIKRPISMSQIHTKLKKGDYANISDLTADLYLMLDNAKKAF
PSSHRTHKDAIKMLKLMNAKLVEESLEETSDMDEDEVDELEAEIFTTVQPEKRKPGRPRI
NSNSNSNASHTTNNSNSPKSNRIAINAAIKKKILSIQKYLVDYSVGNRRPIEMFMEKPPR
KIYPDYYDIIQSPIDMNTIEHNIRTDRYATVEDVVSDYRLMFSNCRQYNEEGSNIYEDAN
TLERALNDKLKEFPGLVEVKKPLQKYSKVGRKPKAALITDRLWQFYETVREYQEPKGKRQ
LSLIFTKLPSKIEYPDYYDIIKDPIDMERIAQKLKQGAYESLDDLAADFLLMLENACKYN
EPDSQIYKDALVLQQLTLQLKQQLRPERDSLPDVPLAVQELFLTLFTTLYNHQDEEGRCY
SDSLAELPEYDEQGDAPKVRGISLDLVKRRLDKGAYKRLDTYQEDIFACLERARKLSRTD
SDIFQDSIELQTYFIRKRDELCKDTLSSPALSFSLERLLADVEVMRQQKAQQEEQDQEQD
KEKDEFNAAKGESMTINQQVFSPGDYVYVQMPEHKIPSIACIERLWTSPTNEKLMQGSIF
VRPHETYHVTTRKFLEKEVFKTSISQTISMDKVLGMCCVMHIKEYIKMRPDRLPEKDVFV
CESRYNIQGRCFKKLKNWPPAREGSSVKFVPREQPLELKRVMSVFKERIEKHKGELEELK
LQETLVEKEKPNVSCDPPPNAEANSTYYQQYNTVCSGAIKTGDFVYVATQTGKQSVAQVQ
QIWEQNGKSYFKGPWLLPPSEVTFGLAKQFFRQELLLGTVEEVSPVVGIVGRCAVLEYGE
FITSRPTEIPESDVYICESVYDEVKKAIRKLVVGNMRKFQHSPAVTEDEVFFFKTPIKPG
KDVKNELNELSMLEDSMDGDTPSLSSDIAAMSSPAPSVNSTPLTSKIKAAKAAKKCLTGY
ILYSSEVRKSICQSNPDASFGDISRMVGTEWKNLPSSVKQTWEDRASKQNEETAAMRREM
DGEIQNSASPSPQVLHDTSGHGLTFECQWDKCDFQFEEMADCVEHCLSDTTGHIQRHPQA
GMDFEYVCLWRNCPRIKKSTQAFPNVLRLIKHVREVHLSKCGKTLGPGERSKNYIPRRQT
RGPLATAMPLASSNSPRNLDAVHLQQHQHVLHQPVHQHQLQQQTIVLGPPPEPLFVTVPP
RTTRVIHSEAYIKYIESLQTGSHLNVATCNNSWRRALTHVTPAQVVAKNPLPEHWLGPNL
RDQGNVVQALCHLRNFMLDDVLQIRRSCN
Download sequence
Identical sequences XP_017104981.1.53830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]