SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017117473.1.32376 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017117473.1.32376
Domain Number 1 Region: 616-675
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.95e-17
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 2 Region: 138-190
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000443
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 3 Region: 340-392
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000555
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 4 Region: 669-726
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000036
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 533-583
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000101
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 6 Region: 587-641
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000238
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 7 Region: 474-521
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000398
Family Classic zinc finger, C2H2 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_017117473.1.32376
Sequence length 1276
Comment PREDICTED: zinc finger protein 236 [Drosophila elegans]; AA=GCF_000224195.1; RF=representative genome; TAX=30023; STAX=30023; NAME=Drosophila elegans; AL=Scaffold; RT=Major
Sequence
MNNQRYGGIQWIQHHVSTGDSSEVDILESDSGAGATGEDLDHMAAENLIFMARDGQLSEI
MAANEAGGTVLVTADGTTVAYAESFDDDAQVVTEEVITDDWVQHQGAERVEIAAEQIAGI
SSSQELLDMEQDEYTALRPYPCDFCSRRFRKKATLNNHMLAHQNDRPHLCKLCGARFSRR
AELISHFKAHAEAQDAADAEAAAAAADSSSSIKFEHQSQRQLDDHYYEQEWPLYQQQQEQ
EQSHQDVQHHHHIVEEGEVQLVASYPAAVAPPAAPTRGRISRLKPKEESSQFIVISEKPI
TSELSDYMDSEPAQPVVTTSQPMAVEPPPQPNFPVLDDSKPFVCQQCGLAFAREKALVSH
TKNHRVDSPFECNQCQEMFWDNSSLQEHQKTHQFEESNSEYDPASADDSGSESEPEDQLY
GEFYCNECGISFHRQDLLRRHAKLHYKLTDQTAGEGNSDAATGGELELAKDSGGHCCHTC
GKSFPSALEMLAHAEIHARFPPFKCVLCGISFYEEQAIKRHLHTRHPSELKANSCVLCGK
ECRDRKALIKHAWDHSREKCHSCSKCGKNFHNKARLKRHMASHRDKSVVCEVCQEEFPDG
RTLSNHRHSHSTTSPGKLFPCHECGKTFGSRSSQQIHVRIHTGERPYGCRYCWKAFADGG
TLRKHERIHTGEKPYACSVCPRAFNQRVVLREHIRSHHSGLDVARNTYHCTVCSEDLASS
NDLIQHLIQHSDSNTAKQRQPITGPRKYKRRRKLQPHEIAHMRAEHKDANGEEEEAMGEG
DADEYTSDIDLCDFDVENVDDLFDMAESPKKEKRKRAPAAPKADPKPMSNGKTAKSAQEK
NKAKSRYDSTSSQQSDRIWEEKFLQDSQVALFQIDSLVVVNDTHLQPASSTGSAVVPNTR
AKQQGKVQAKPTDGAGSFNTSVSTSSAASTSTSSSRSRKRAGNTKTASKAPSAGNSRPRM
IHTEKAKLPKGAGGESSSSAAKKTRSKTYISRTETTNLDLDKSRSSASNMVDDYEIISPA
THPPNQISSSPLHIKQEQEQRVQLMYDDNLLIDAALLREKTYEKFNPSIVNDLEEILRSP
LKHERNSRLRFTSESSTTPQFLPEEEQNLIKIEPTSPDLREMVESQQRVTAPSGSTPSSS
SSARTSRHLRQITANGTRAGSKRSAGGINSKSSPGTGAAAKKGNTATKVGSSSSSYLNYG
VDAYNVNVPASASNADVGSGFFSISEVVSAADAADAAAKAAAAGKLERKSRSFECEMCSA
IFYDRGQLLEHVHIHI
Download sequence
Identical sequences XP_017117473.1.32376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]