SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017155599.1.22881 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017155599.1.22881
Domain Number 1 Region: 72-521
Classification Level Classification E-value
Superfamily Sema domain 2.88e-130
Family Sema domain 0.0000545
Further Details:      
 
Domain Number 2 Region: 1390-1519,1728-1889
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.28e-43
Family p120GAP domain-like 0.034
Further Details:      
 
Domain Number 3 Region: 883-977
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000764
Family Other IPT/TIG domains 0.0074
Further Details:      
 
Domain Number 4 Region: 524-575
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000301
Family Plexin repeat 0.0021
Further Details:      
 
Domain Number 5 Region: 976-1064
Classification Level Classification E-value
Superfamily E set domains 0.00000000000777
Family Other IPT/TIG domains 0.081
Further Details:      
 
Domain Number 6 Region: 1083-1165
Classification Level Classification E-value
Superfamily E set domains 0.0000102
Family E-set domains of sugar-utilizing enzymes 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_017155599.1.22881
Sequence length 1946
Comment PREDICTED: plexin-A2 isoform X1 [Drosophila miranda]; AA=GCF_000269505.1; RF=representative genome; TAX=7229; STAX=7229; NAME=Drosophila miranda; strain=MSH22; AL=Chromosome; RT=Major
Sequence
MHFFLWFLLLATLGDHHEYWLRSGHSRTVAARFRAERMVASLQNDSISLTDANVAVNEAK
NLSTTITNVANFDTRLNHILVDTITGRVFVGGVNRLYQLSPDLDLHETVKTGPQNDSVEC
SILDCPLNAVRSPTDNYNKVLLIDRATSRLIACGSLFQGTCTVRNLQNVSIIEHEVPDAV
VANDAKSSTVAFIAPGPPQHPVTNVMYVGVTYTNNSPYRSEIPAVASRSLEKTKMFQIAS
SAVTTGTRTFINSYARESYFVNYVYGFSSERFSYFLTTQLKHNHHSSPKEYITKLVRICQ
EDSNYYSYTEIPVECISEAQGGTKFNLVQAGFLGKPSSDLAQSLGISIQDDVLFAVFSKG
DGNAPTNSSALCIYSLKSIRRKFMQNIKSCFNGNGMRGLDFISPSMPCVLTKLQTIGEDF
CGLDVNSPLGGENPITSVPVAMFSTRLTSVAATSTSGYTVVFVGTVDGYLKKVVVESSSV
ANEYASFPVDVGSAINQDMKFDNQNLYIYAMSESRVSKVKVFDCSDYKTCGECLGARDPY
CGWCSLENKCSPRSNCQDDANDPLYWVSYKTGKCTTITSVVPHQLQRTTARTLELIIDHL
PQLKENLICAFTTEDKALFTNATKKRNGVNCTTPRTDMLPQIEQGKHHFTAKLSVRTRNG
PDLVSTDFTFFDCSTHSSCTRCVSSEFPCDWCVEAHRCTHDTAENCRNDILVTGVSRIGP
SYRSGPGFCPTINATGDGSEVLVAAGTSKSIKVKVHIIGQFIVQTRFVCQFNIEGRVTSL
NAQLLGDTIYCDSMEFQYTSRSPNLTATFAVIWGGSKPLDNPHNIHVVIYRCRDMSDSCG
ICLALADKYNCGWCSSTNTCEVEEQCNKNNEGKTDWLNRSEICPNPEIHTFDPKTGPWEG
GTNITIRGINLGKNYNDIYSGVRIAGINCMPFPQFYIDTKQIVCTVDSPGEQMYRNGRIV
VQIGDYRGESKEDYEFVDPKILDFNPKFGPTSGGTEVHISGKHLNAGSRIQASINDHLPC
KILSADSSQAICRTSPSPGIIEGRLKMSFDNGPREFNDYNFKYVLDPTVEHVSSGPTGQI
KVPKGIPAGGIRISVIGTQFTSIQSPSIYVVYNTEMYASQCRVQSDLEMECASPIIETDS
KYLDAESPMLLEYGFLMDNVLGVQNLSKIHNNHFELYPNPEYFVFEERVKYFKSEYLTIN
GRNLDRACKESDVEVRIGNGFCNITSLSRQQLTCRPPPESTATKSPNGPEVIVRIGSSLE
YRIGILSYESSNIILDWGENVIVAVIASIVILLLVFVALLVAYKKKSSESNRVLRNMQEQ
MDILELRVAAECKEAFAELQTEMTDLTGDLTSGGIPFLDYRSYAMKILFPNHEDHVVLQW
ERPELLRKEKGLRIFGQLIMNKTFLLLFIRTLESNRYFSMRERVNVASLIMVTLQSKLEY
CTDILKTLLGDLIEKCIEGKSHPKLLLRRTESVAEKMLSAWFTFLLYKFLKECAGEPLYM
LFRAVKGQVDKGPVDACTHEARYSLSEEKLIRQSIDFRPMNVYASIIQQPIFCNNLDMLP
SHTENVSVKVLDCDTIGQVKEKCLETIYRNIPSSQRPRKEDLDLEWRTGATGRVILYDED
VTSKTESEWKKLNTLQHYNVPDGAGLSLVPKQSSIYNFSILSDKNEKSHKYETLNISKYT
SSSPTFSRAGSPLNNDMQDSGIRYWHLVKHHDSDMQKEGERVNKLVSEIYLTRLLATKGT
LQKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDDQAQLHGITDPEVVHTWKSNSLPLRF
WVNLIKNPNFVFDIHKSNIVDSCLSVVAQTFMDSCSTSDHRLGKDSPSSKLLYAKDIPEY
RKWVDRYYRDIRDMSPISDQDMNAMLAEESRLHTTEFNTNCALHELYTYAVKYNEQLTVT
LEEDEFSQKQRLAFKLEQVHNIMSAE
Download sequence
Identical sequences XP_017155597.1.22881 XP_017155598.1.22881 XP_017155599.1.22881 XP_017155600.1.22881

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]