SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017170779.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017170779.1.92730
Domain Number 1 Region: 600-657
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.73e-25
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 2 Region: 320-377
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.23e-24
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 3 Region: 432-489
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.44e-24
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 4 Region: 376-433
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.09e-23
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 5 Region: 544-601
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.58e-23
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 6 Region: 264-321
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.47e-23
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 7 Region: 208-265
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.01e-22
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 8 Region: 42-99
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.35e-21
Family KRAB domain (Kruppel-associated box) 0.00015
Further Details:      
 
Domain Number 9 Region: 152-209
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.93e-21
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 10 Region: 489-545
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.59e-21
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 11 Region: 642-694
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-19
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 12 Region: 114-166
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000488
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_017170779.1.92730
Sequence length 702
Comment PREDICTED: zinc finger protein 431-like [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MLDQISVSEFVAETLEDYKAPTASCFTTGTAQCRDTVAAIDEDAVTYDDVHVNFTGEEWN
LLDPSQKSLYKDVMLETYWNLTVIGYTWENHHIERHCQSSRRNERYVSNHSGEKLYECNE
RSKAFSCPSHLQCHKKRQIGEKTHEHNQCGKAFPTPSHLQYHKRTHTGEKPYECHQCGQA
FKKCSHLQRHKRTHTGEKPYECNQRGKAFGRPSHLQYHKRAHTRVKPYECNQCGKAFTSH
SGFQYHKRTHTGEKPYECNQCGKAFACHSYLQCHKRIHTGEKPYECNQCGKAFAQLNNLL
CHKRTHTGEKPYECNQCGKAFVLLSSFQFHKRTHTGEKPYECNQCGKAFASHSYLQRHKR
THTGEKPYECNQCGKAFTSHSGLQYHKRSHTGEKPYQCNQCGKAFADHSILQYHKRTHTG
EKPYECNQCGKAFAQLTNLQYHKRTHTGEKPYECIQCGKAFARPSLLQFHNRTHTGEKPY
ECNQCGKAFALLFSFQCHKRIHTGEKPYECIHCGKAFARPSLLQFHKRTHTGEKPYECIQ
CGKAFARPSHLQHHKRTHTGEKPYECNQCGKAFTSHNGLQCHKRTHTGEKPYECNQCGKA
FARHSNLQHHKRTHTGEKPYECNQCGKAFAQLSSFQRHKRTHTGEKPYECNQCGKAFARH
SYLQCHKRTHTGEKPYECNQCGKVFSQHSHLQCHKRTHTFPI
Download sequence
Identical sequences XP_017170779.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]