SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017171167.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017171167.1.92730
Domain Number 1 Region: 304-361
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.89e-24
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 2 Region: 164-221
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.13e-24
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 3 Region: 220-277
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.15e-24
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 4 Region: 360-417
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.18e-23
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 5 Region: 416-473
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.49e-23
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 6 Region: 108-165
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.34e-23
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 7 Region: 472-529
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.12e-22
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 8 Region: 528-585
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.14e-22
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 9 Region: 2-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.12e-20
Family KRAB domain (Kruppel-associated box) 0.00015
Further Details:      
 
Domain Number 10 Region: 70-122
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.69e-18
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 11 Region: 570-618
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000556
Family Classic zinc finger, C2H2 0.0099
Further Details:      
 
Domain Number 12 Region: 267-299
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000563
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_017171167.1.92730
Sequence length 650
Comment PREDICTED: LOW QUALITY PROTEIN: zinc finger protein 431-like [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MDAVTFDDVHVNFTKEEWNLLDPSQMNLYKDVMLDTYWNLTSIGYKWEDHHIEEPCQSSQ
RHTRSHRWKKLYECNQCGKVFARPDLLQCHKRTHTGEKPYECNQCGKAFSSHSGLRYHKR
NHTGEKPYECNQCGKAFSSHSGLRYHKRNHTGEKPYECNQCGKAFSSHSNLRYHKRNHTG
EKPYECNQCGKAFARPADLQCHKRTHTGEKPYKCNQCGKAFSCHSGLRYHKRTHTGEKPY
ECNQCGKAFSSHNSLRYHKRTHTGEKPYECNQCGKAFSSHSGLRYHKRNHTGEKPYECNQ
CGKAFSSHSGLRYHKRNHTGEKPYECNQCGKAFSSHSNLRYHKKTHTGEKPYECNQCGKA
FARPADLQCHKRTHTGEKPYKCNQCGKAFSCHSGLRYHKRTHTGEKPYECNQCGKAFSSH
NSLRYHKRTHTGEKPYECNQCGKAFARPAYLQHHKTTHTGEKPYECNQCGKAFARPDLLQ
CHKRTHTGEKPYECNQCGKAFSCHSGLRYHKRTHTGEKTYECNQCGKAFSCHNSLRYHKR
THTGEKPYECNQCGKAFATSSHLQCHKRTHTGEKPYKCNQCCKAFQVTXHLQXHKRSHTR
EKPHECCQCSKAFACLNSSHVYKVKHTGENPHYCNHCGKNLGNLLSSATT
Download sequence
Identical sequences XP_017171167.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]