SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017186296.1.92800 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017186296.1.92800
Domain Number 1 Region: 36-320,489-544
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.59e-47
Family FAD-linked reductases, N-terminal domain 0.000000298
Further Details:      
 
Domain Number 2 Region: 324-490
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 3.63e-22
Family GMC oxidoreductases 0.00000278
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_017186296.1.92800
Sequence length 550
Comment PREDICTED: (R)-mandelonitrile lyase 2-like [Malus domestica]; AA=GCF_000148765.1; RF=representative genome; TAX=3750; STAX=3750; NAME=Malus domestica; cultivar=Golden Delicious; AL=Chromosome; RT=Major
Sequence
MEKSTTAAILLVFYIFVLCPQPGIHSLAPPSDVRDFSYLKFVRNATDLPLQEEYDYIVVG
GGTAGCPLATTLSANYSVLLLERGDIPTTYPSVSTVEGILENFMLEDDGTTPLQRFVSED
GVANVRGRILGGTSMVSGGAYSRADSEFYKKSGIKLDMNLVNKSYEWVEDTIVFRPNVSQ
WQSVVKDALLEAGVRPDNGFTLDSVEGTKISGALFDNRGRRYGAVELLNKGHPKNLRVAI
HATVERIIFSSKASDPSAKGIIYNDSNGRSHWASIRGKGEVILSAGAIGSPQLLLLSGVG
PKSYLTSLKIPVVHPQPYVGKFMRDNPRSNIIILPPSPIVPTYSQIAGFTSDFDIESISG
TPYSSQAYSIFPNPTIPVTINSSFGFFMVKVRGPILSHGSLKLQSSYDAKVAPNVKFNYF
AKEGDLSQCVSAMGKMRDLLKTNALKPFKTRDLPGLEGFNLFKPSLPMNQSDDASFCRDT
VATHWHYHGGCSAGKVVDGDLRVTGIKALRVVDGSIFNSSPGTNPQATLMMLGRYVGLRI
LEERSASKGR
Download sequence
Identical sequences XP_017186296.1.92800 MDP0000137211 MDP0000137211|PACid:22645789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]