SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017186747.1.92800 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017186747.1.92800
Domain Number 1 Region: 15-357
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.53e-33
Family GDI-like N domain 0.00019
Further Details:      
 
Domain Number 2 Region: 381-497
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.00000000000267
Family GDI-like 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_017186747.1.92800
Sequence length 566
Comment PREDICTED: rab proteins geranylgeranyltransferase component A 2-like [Malus domestica]; AA=GCF_000148765.1; RF=representative genome; TAX=3750; STAX=3750; NAME=Malus domestica; cultivar=Golden Delicious; AL=Chromosome; RT=Major
Sequence
MSDSSLYDPIELETTTFDLIVVGTGLPATIIAAAASASGKTVLHLDRNHFYGSQFASLQL
DELTSFIKSHATPPSTIIGSTSTGSSLDYTALDVTLRSVYSNIETANYAPEILANQFSKF
LIDLGGPRXLFCADKAIDLIAKSGVGSYLSFKSIDVSFICDENGRLSNVPDSRSAIFKDK
SLSLIEKNQLMRFFKLVQQHLAASAGDDGGNESAKISEEDLESPFADFLKRMRLPPKIKS
SILYAISLADDDQDNSEVCKTVLKTREGMERLDLYQKSVGRFPNVPGALLYPLYGHGEIL
QGFTRRAAVKGCIQVLRMPLTALLMDKQTGQYKGVRLASGEEIFSHQLLLDPTLTVPLPP
ASSSPNLEETLQVLSLKGDKRKVARGICITTSSLKPDVSNCLLVYPPRFLFSEQDTSIRA
IQIGGGSDKLAVCPSGMFVLYFSGLCDDAEHGKRLLHAAMNALLTLPVSANRESGSAVQS
EDADVKPTLLWSTLYIQELTTAHNGECENIFFTPMPDGNLNYNDLVDSTVALFQKMYPDE
VFFAETPSSPVEPDNPEDDTELSLDS
Download sequence
Identical sequences MDP0000829384|PACid:22650105 MDP0000829384 XP_017186746.1.92800 XP_017186747.1.92800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]