SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017193540.1.1745 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017193540.1.1745
Domain Number 1 Region: 505-562
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.78e-23
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 2 Region: 309-366
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.78e-23
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 3 Region: 228-282
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.01e-22
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 4 Region: 449-506
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.56e-22
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 5 Region: 366-422
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.97e-22
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 6 Region: 23-79
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 8.76e-20
Family KRAB domain (Kruppel-associated box) 0.00098
Further Details:      
 
Domain Number 7 Region: 185-245
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.42e-19
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 8 Region: 551-603
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.88e-17
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 9 Region: 157-207
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.91e-16
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 10 Region: 121-170
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000131
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 11 Region: 412-444
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000325
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 12 Region: 272-304
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000301
Family Classic zinc finger, C2H2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_017193540.1.1745
Sequence length 605
Comment PREDICTED: LOW QUALITY PROTEIN: zinc finger protein 791 [Oryctolagus cuniculus]; AA=GCF_000003625.3; RF=representative genome; TAX=9986; STAX=9986; NAME=Oryctolagus cuniculus; breed=Thorbecke inbred; AL=Chromosome; RT=Major
Sequence
MHVTGTQTSQGVHWQEATVRSQTQDSVVFEDVSVNFSREEWALLNPSQKKLYRDVMQETI
RNLASVEQKREDQNIKDQYKKQARTLRSCVVERNCESKKESQCGDAFSQSKSQPDREKDW
SKPYECTVCGKDYVLHSSLVRHIRSHAGYKLAGSKYGEKPYKCKVCGNAFSYLKSFQRHE
RTHTGENPYKCQQCGKTFIYHQPFQTHEQTHTGEKPYECQYCGKSLSSSSSLRIHERIHT
GEKPYACKKCGKAFSCPSSIQIHERTHTGEKPYTCKECGKAFISRTSVQTHMITHNGDRP
YKCQECGKAFIRPSFLRVHERIHTGEKPYACKQCGKAFRCSTSIQIHERTHTGEKPYKCK
DCGKAFRARPAFRVHLRVHTGEKPYKCKECGKAFSRLSYCRIHERTHTGEKPYKCKKCGK
TFNYPLDLQIHERNHTGEKPYECKQCAKAFISVENFRRHMITHTGDGPYKCRECGKAFSY
LSALRTHERTHTGEKPYTCKRCGKSFSCSSYVQIHERTHTGEKPYECKECGKAFIYPTSF
QGHMRVHTGEKPYKCKECGKAFSLRSSSQRHERTHSGEKLYECKQCGKAFCLSRSLQKHV
TMHTG
Download sequence
Identical sequences XP_017193540.1.1745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]