SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017194751.1.1745 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017194751.1.1745
Domain Number 1 Region: 117-562
Classification Level Classification E-value
Superfamily Sema domain 1.7e-115
Family Sema domain 0.00023
Further Details:      
 
Domain Number 2 Region: 1410-1539,1716-1902
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.41e-48
Family p120GAP domain-like 0.02
Further Details:      
 
Domain Number 3 Region: 897-991
Classification Level Classification E-value
Superfamily E set domains 1.17e-17
Family Other IPT/TIG domains 0.0046
Further Details:      
 
Domain Number 4 Region: 989-1079
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000675
Family Other IPT/TIG domains 0.047
Further Details:      
 
Domain Number 5 Region: 565-614
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000645
Family Plexin repeat 0.0019
Further Details:      
 
Domain Number 6 Region: 1077-1189
Classification Level Classification E-value
Superfamily E set domains 0.00000689
Family E-set domains of sugar-utilizing enzymes 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_017194751.1.1745
Sequence length 1935
Comment PREDICTED: plexin-B2 [Oryctolagus cuniculus]; AA=GCF_000003625.3; RF=representative genome; TAX=9986; STAX=9986; NAME=Oryctolagus cuniculus; breed=Thorbecke inbred; AL=Chromosome; RT=Major
Sequence
MVTLGWAWGASLYWGAILRPLVPWRPGLLRWDGHCGTGLREQHGWDSAGGRAPVQLSGPA
AAVCVASRTCTPKLQPGMRPRGNPPPARLSGAMALQLWALTLLGLAGMGSNLRPGRLDFF
HSDTELNHLAVDQASGVVYVGAVNALYQLSADLQLEQKANTGPALDNKKCTPPIEASQCH
EAVLTDNVNQLLLLDPPGRRLVECGSLFKGICALRALSNISTRLFYEDSSGEKSFVASND
EGVATVGLVSATGPGGERVLFVGKGNGPHDNGIIVSTRLLDRAEGREAFEAYTDHATYKA
GYLSTSTQQFVAAFEDGPYVFFVFNQQDKHPAHNRTLLARMCRQDPFYYSYLEVDLQCHD
PSDPQAPAFGTCLAASVATPGAGRVLYAVFSRDGRGGHGGPGAGLCLFPLDEVHTKMEAT
RKACYAGTREAGRSDLFYKPFHGEIQCGNHGLDASKNFPCGSEHLPYPLGSRDGLTATAV
LQRGGLNLTAVVVTAENNHTVAFLGTSDGRILKVYLAPDGTSTEYGSILVEINKRIKQDL
VLSGDLASLYAMTQDKVFRLPVQECLSYSSCAQCRDSQDPYCGWCVIKGRCTRRAECPRA
EETGHWLWSWDKSCVAITDAQPQNMSRRAQGEVQLTVSPLPDLSADDELLCLFGASPPHP
ARVEGDTVVCNSPSSIPSTRPGEDHVAVTIQLLFRHGNVSLTSHEYPFYDCREAMSLVEK
LPCISCASNRWTCQWDLRYHECREASPNPEDGIVRAHMEDNCPQFLNPSPLVVPMNHETA
VTFQGKNLDTVKGSSLYVGSDLLKFEEPVTMQEPGVFFFQTPKLSHDANETLPLHLYVKS
YGKNIDSRLQVTLYNCSFGRSDCSLCLAADPAYRCVWCGGQGRCVYEALCSNATSECPPP
VITKIQPETGPLGGGIRVTIHGSNLGIRADDVQRVTVAGQDCVFEPELYSVSTRIVCVIG
AAEAPCTGGVEVDVSGKLGHSPPSVQFTYQQPQPLSVEPRQGPQAGGTTLTISGTHLDTG
SEEDVRVTLSDVPCKVTKFGAQLQCVTGPQAALGEVPLEIFYGGSLVPSPGVSFTYRENP
VLRAFEPLRSFVSGGRSINVTGHGFSLIQKFAMVVIAEPLQSWRQRREAGPLHPVTVTGT
EYVFHNDTKVVFLSPAVPEEPEAYNLTVLIQMDGHRALLRTEAGAFEYVADPTFENFTGG
VKKQVNKLIHARGTNLNKAMTLHEAEAFVGAERCVMKTLTETDLYCEPPEVQPPPKRRQK
RDTAHNLPEFIVKFGSREWVLGRVEYDTRVSDVPLSLILPLVMVPMVAVIAVSVYCYWRK
SQQAEREYEKIRSQLEGLEESVRDRCKKEFTDLMIEMEDQTNDVHEAGIPVLDYKTYTDR
VFFLPSKDGDKDVMITGKLDIPEARRPAVEQALYQFSNLLNSKSFLINFIHTLENQREFS
ARAKVYFASLLTVALHGKLEYYTDIMRTLFLELMEQYVVAKNPKLMLRRSETVVERMLSN
WMSICLYQYLKDSAGEPLYKLFKAIKHQVEKGPVDAVQKKAKYTLNDTGLLGDDVEYTPL
TVSVIVQDEGVDAVPVKVLNCDTISQVKEKIIDQVYRTQPCSCWPKPDSVVLEWRPGSTA
QILSDLDLTSQREGRWKRINTLMHYNVRDGATLILSKVGVSQQPEDSQQDLSGERHALLE
EENRVWHLVRPAEEVDEGKSKRGSVKDKERTKAITEIYLTRLLSVKGTLQQFVDNFFQSV
LAPRHAVPPAVKYFFDFLDEQAEKHDIKDEDTIHIWKTNSLPLRFWVNILKNPHFIFDVH
VHEVVDASLSVIAQTFMDACTRTEHKLSRDSPSNKLLYAKEISTYKKMVEDYYKGIRQMV
QVSDQDMNTHLAEISRAHTDSLNTLVALHQLYQYTHKYYDEIINALEEDPAAQKMQLAFR
LQQIAAALENKVTDL
Download sequence
Identical sequences XP_017194751.1.1745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]